(data stored in ACNUC7421 zone)

EMBL: CP001791.PE334

CP001791.PE334       Location/Qualifiers
FT   CDS             complement(360759..361724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0346"
FT                   /product="selenide, water dikinase"
FT                   /note="KEGG: sfu:Sfum_3401 selenide, water dikinase;
FT                   TIGRFAM: selenide, water dikinase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97886"
FT                   /db_xref="GOA:D6XWP4"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP4"
FT                   /inference="protein motif:TFAM:TIGR00476"
FT                   /protein_id="ADH97886.1"
FT                   /translation="MRHLPEGTKNENLLVGLDTSDDGGVFKLTDDLAIVQSIDYFTPIC
FT                   DDPYMFGQIAAANALSDIYAMGGKPVTALNIVGYPIKKMPPETLAEILRGGADKIQESG
FT                   AVLAGGHSIDDQEPKYGLSVTGTVHPDAIFKNVGAKTGDKLVLTKPLGAGIITTAIKFG
FT                   KASEQEQKDVMTAMATLNKTAAETLADFHPHAVTDVTGFGLTGHGFEMASGSNVTLHIS
FT                   YKDVPVINGTLSHARNKVIPGGGRENRDYLLEHVEHAPHIELADQLILSDSITSGGLLV
FT                   SLPADEADAYVEAYNRAQDTFKAAVIGHVTDFEGHAIKIR"
     MRHLPEGTKN ENLLVGLDTS DDGGVFKLTD DLAIVQSIDY FTPICDDPYM FGQIAAANAL        60
     SDIYAMGGKP VTALNIVGYP IKKMPPETLA EILRGGADKI QESGAVLAGG HSIDDQEPKY       120
     GLSVTGTVHP DAIFKNVGAK TGDKLVLTKP LGAGIITTAI KFGKASEQEQ KDVMTAMATL       180
     NKTAAETLAD FHPHAVTDVT GFGLTGHGFE MASGSNVTLH ISYKDVPVIN GTLSHARNKV       240
     IPGGGRENRD YLLEHVEHAP HIELADQLIL SDSITSGGLL VSLPADEADA YVEAYNRAQD       300
     TFKAAVIGHV TDFEGHAIKI R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page