(data stored in ACNUC7421 zone)

EMBL: CP001791.PE335

CP001791.PE335       Location/Qualifiers
FT   CDS             complement(361861..362247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0347"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97887"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP5"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ADH97887.1"
FT                   /translation="MKQLLIVLSGLFLLGACGGTADLDGLNTMTATDLEAQTEQGLEDD
FT                   VQYIDVRETDEFDEESIPGFENMPMALVMDNPSLLNEEEDVVILCNTQNRSKEVAEALI
FT                   DAGFDHDRVIVVEGGISDYNGTVN"
     MKQLLIVLSG LFLLGACGGT ADLDGLNTMT ATDLEAQTEQ GLEDDVQYID VRETDEFDEE        60
     SIPGFENMPM ALVMDNPSLL NEEEDVVILC NTQNRSKEVA EALIDAGFDH DRVIVVEGGI       120
     SDYNGTVN                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page