(data stored in ACNUC7421 zone)

EMBL: CP001791.PE337

CP001791.PE337       Location/Qualifiers
FT   CDS             363335..364210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0349"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: afw:Anae109_3021
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97889"
FT                   /db_xref="GOA:D6XWP7"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP7"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADH97889.1"
FT                   /translation="MNVKRSLFILSGLFLLGACGNEQEEPFEVAVIPSQSIGEMQEGLD
FT                   LLEAELEAALGRVVKVEHYPNYNAVVEAINHSHIDLAYVGPVTYLIARNQSGAEAVLTQ
FT                   SINGSPYYHSYIKAHVDAPWDTLDELLADVGDVSFAFGSHSSTSGFTVPGYELMNQGVY
FT                   RDENDHDFIDVRFTGSHDITAQALLSQDVDAGAIDSAIYHALVEEGSVDDSRLKTIWES
FT                   EPLYQYPWIVPSDKDEDEIEAIQEAFLAIEEPEILRIFGGADAFVLADVANYEGIEDAA
FT                   RAVGLLDDEE"
     MNVKRSLFIL SGLFLLGACG NEQEEPFEVA VIPSQSIGEM QEGLDLLEAE LEAALGRVVK        60
     VEHYPNYNAV VEAINHSHID LAYVGPVTYL IARNQSGAEA VLTQSINGSP YYHSYIKAHV       120
     DAPWDTLDEL LADVGDVSFA FGSHSSTSGF TVPGYELMNQ GVYRDENDHD FIDVRFTGSH       180
     DITAQALLSQ DVDAGAIDSA IYHALVEEGS VDDSRLKTIW ESEPLYQYPW IVPSDKDEDE       240
     IEAIQEAFLA IEEPEILRIF GGADAFVLAD VANYEGIEDA ARAVGLLDDE E                291
//

If you have problems or comments...

PBIL Back to PBIL home page