(data stored in ACNUC7421 zone)

EMBL: CP001791.PE339

CP001791.PE339       Location/Qualifiers
FT   CDS             364989..365729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0351"
FT                   /product="phosphonate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphonate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; KEGG: bba:Bd3104
FT                   phosphonate ABC transporter ATP-binding protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97891"
FT                   /db_xref="GOA:D6XWP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWP9"
FT                   /inference="protein motif:TFAM:TIGR02315"
FT                   /protein_id="ADH97891.1"
FT                   /translation="MIQVEGLSVTFGGNVQALSGIDFTVGDGEFICVLGRSGAGKSTLI
FT                   RCLNGLQRPSAGIVTVNGETLTSKTEQDLRRIRADIGMIFQHFQLIPRLTVAMNVYLGM
FT                   AGKRPWWKTVMGFQTDSEKARVDTALREVEIGDYAHRRVEELSGGQKQRVAVARALVQE
FT                   PFLLLGDEPVASLDPGTSERLFQKLKDLHDNRGITMFINVHDVTLAKRYANRILALKDG
FT                   ALIFDGPPEAFDEEAYRETYATTT"
     MIQVEGLSVT FGGNVQALSG IDFTVGDGEF ICVLGRSGAG KSTLIRCLNG LQRPSAGIVT        60
     VNGETLTSKT EQDLRRIRAD IGMIFQHFQL IPRLTVAMNV YLGMAGKRPW WKTVMGFQTD       120
     SEKARVDTAL REVEIGDYAH RRVEELSGGQ KQRVAVARAL VQEPFLLLGD EPVASLDPGT       180
     SERLFQKLKD LHDNRGITMF INVHDVTLAK RYANRILALK DGALIFDGPP EAFDEEAYRE       240
     TYATTT                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page