(data stored in ACNUC7421 zone)

EMBL: CP001791.PE340

CP001791.PE340       Location/Qualifiers
FT   CDS             complement(365811..366773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0352"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: aeh:Mlg_0734 response
FT                   regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97892"
FT                   /db_xref="GOA:D6XWQ0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ0"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADH97892.1"
FT                   /translation="MFKGNKKLVAAAAGLSLTLVATACGNDGNNEENTGNNNDDANVNE
FT                   NAGDDNAANDGAMVGEGKEIELVYVEWDSEIASTHVVANVLESQGYDVTITPIDNAIMW
FT                   QSVANGEADGMVAAWLPATHGDLFAEYEDDLVDLGVNLEGALVGLVVPEYMTIDSIADL
FT                   DQYEDELGGTITGIEPGAGVVQAAEASVEDYGLDGFSVETSSSGAMATALGEAVGNEEP
FT                   IVVTGWTPHWKFSAYDLKYLEDPEGSFGEAEVIQTMVRQGLEEDMPNAFRILDQFFWTT
FT                   EDMESIMLEIQEGTDPEDAAADWVEANQDVVDGWLEGVE"
     MFKGNKKLVA AAAGLSLTLV ATACGNDGNN EENTGNNNDD ANVNENAGDD NAANDGAMVG        60
     EGKEIELVYV EWDSEIASTH VVANVLESQG YDVTITPIDN AIMWQSVANG EADGMVAAWL       120
     PATHGDLFAE YEDDLVDLGV NLEGALVGLV VPEYMTIDSI ADLDQYEDEL GGTITGIEPG       180
     AGVVQAAEAS VEDYGLDGFS VETSSSGAMA TALGEAVGNE EPIVVTGWTP HWKFSAYDLK       240
     YLEDPEGSFG EAEVIQTMVR QGLEEDMPNA FRILDQFFWT TEDMESIMLE IQEGTDPEDA       300
     AADWVEANQD VVDGWLEGVE                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page