(data stored in ACNUC7421 zone)

EMBL: CP001791.PE343

CP001791.PE343       Location/Qualifiers
FT   CDS             369169..369720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0355"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: bja:bll3994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97895"
FT                   /db_xref="GOA:D6XWQ3"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ3"
FT                   /inference="protein motif:COG:COG1510"
FT                   /protein_id="ADH97895.1"
FT                   /translation="MSSEEKLLSEQEQLDAARGRFISEIAKNIHLYDLPPSIGRLYGTV
FT                   FFSKDPMTLDEMSEEMGMSKTSMSTGIRSLVEADMVERVWEKGVRKDLYKTEEDWYKSF
FT                   STVFIKRWRNATETNLEAIGETEEMLNALKERADHDEVIDEVNIDLEKLHRARKYYEWL
FT                   NEVIALFETGEIFEIVPKKE"
     MSSEEKLLSE QEQLDAARGR FISEIAKNIH LYDLPPSIGR LYGTVFFSKD PMTLDEMSEE        60
     MGMSKTSMST GIRSLVEADM VERVWEKGVR KDLYKTEEDW YKSFSTVFIK RWRNATETNL       120
     EAIGETEEML NALKERADHD EVIDEVNIDL EKLHRARKYY EWLNEVIALF ETGEIFEIVP       180
     KKE                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page