(data stored in ACNUC7421 zone)

EMBL: CP001791.PE344

CP001791.PE344       Location/Qualifiers
FT   CDS             369813..370409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0356"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97896"
FT                   /db_xref="GOA:D6XWQ4"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ4"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ADH97896.1"
FT                   /translation="MADDRKSMEQLQDKVNGKLADEEKTRQRPKNVATWRTEKPAVMNN
FT                   GPADFQPKKEKPKKNKPLMILAVLLVAFGGMMLLAFNEDRVMSAYQYITGDYSWQRAHH
FT                   ADEDMFRLSDGNYVQASVTIEVEERGQVRRLNSQDDSVDHIIEEAFMTVNTAEIRSNPG
FT                   KDQVVDEISAMINRDIEGVEVKQVYFRSILSPLAN"
     MADDRKSMEQ LQDKVNGKLA DEEKTRQRPK NVATWRTEKP AVMNNGPADF QPKKEKPKKN        60
     KPLMILAVLL VAFGGMMLLA FNEDRVMSAY QYITGDYSWQ RAHHADEDMF RLSDGNYVQA       120
     SVTIEVEERG QVRRLNSQDD SVDHIIEEAF MTVNTAEIRS NPGKDQVVDE ISAMINRDIE       180
     GVEVKQVYFR SILSPLAN                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page