(data stored in ACNUC7421 zone)

EMBL: CP001791.PE345

CP001791.PE345       Location/Qualifiers
FT   CDS             370511..371143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97897"
FT                   /db_xref="GOA:D6XWQ5"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97897.1"
FT                   /translation="MHILLILLVGIVTLFVAAALIQTIRRRRPDEAVVLDGLKLNIVSR
FT                   GMKLSPAQVKKDGRLKVGFLGAGLVILTGTLVATLITGMTLTLSSIFLLIWLPVYSLLV
FT                   IKVPMLLLTREAWVVDERRFPFEAIKCIEAEPVSVGHEMRGMFDESWAYVAVTIHPRKK
FT                   WSKKALFCVHQDDYEQLKDIARSQSRDYPWEETGTWQKTDGANGSLT"
     MHILLILLVG IVTLFVAAAL IQTIRRRRPD EAVVLDGLKL NIVSRGMKLS PAQVKKDGRL        60
     KVGFLGAGLV ILTGTLVATL ITGMTLTLSS IFLLIWLPVY SLLVIKVPML LLTREAWVVD       120
     ERRFPFEAIK CIEAEPVSVG HEMRGMFDES WAYVAVTIHP RKKWSKKALF CVHQDDYEQL       180
     KDIARSQSRD YPWEETGTWQ KTDGANGSLT                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page