(data stored in ACNUC7421 zone)

EMBL: CP001791.PE347

CP001791.PE347       Location/Qualifiers
FT   CDS             372084..372239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97899"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97899.1"
FT                   /translation="MKQNDEDDLLEKSTGNRKRVEGWRLVVQMIGVCGKEVTDHVRSIK
FT                   EIIMVF"
     MKQNDEDDLL EKSTGNRKRV EGWRLVVQMI GVCGKEVTDH VRSIKEIIMV F                 51
//

If you have problems or comments...

PBIL Back to PBIL home page