(data stored in ACNUC7421 zone)

EMBL: CP001791.PE348

CP001791.PE348       Location/Qualifiers
FT   CDS             372202..373974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0360"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ppr:PBPRA0971 putative transport ATP-binding
FT                   protein MsbA; PFAM: ABC transporter related; ABC
FT                   transporter transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97900"
FT                   /db_xref="GOA:D6XWQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97900.1"
FT                   /translation="MFAALKKLSWFFKQEKKRYIIAILILTVASVLEIIPPRLIGFVVD
FT                   DVHQGRMTEERLFGFVSFFIVLMLVVYVMTYVWMRKLFGGSLLLERTMRSRLMNHLMTM
FT                   TPSFYNRNKTGDLMAKGTNDLKAISQTAGFGILTLVDATVFLVVILVMMTVFISWELTL
FT                   AAFLPFPLMAYLMKVYGKRIHERFMAAQRAFGDLNDQVLESISGVRVIRAFVKEQADRT
FT                   SFSKQTDHVLRQNIRVARVDALFEPTIKILVGMSYMIGLGFGAYLVFQGRITLGQLVTF
FT                   NIYLGMLIWPMFALGELMNIMQRGNASLDRLNHTFEAEPDVKDPDKPLRDLVPNEIVFD
FT                   GLNFSYPKAKEPALSDVSVTIRKGMHIGVAGKTGSGKSTFLRQLLRAYPLHKGALKVNS
FT                   VPFEQVSLSTVKGWIGYVPQESFLFSKSIEANIRFGAGDKVSDDRLRQVMEQAAITKDL
FT                   HTFQDGLETLVGEKGISLSGGQKQRIAIARALMKDPEILILDDAMSAVDAKTEQFIISN
FT                   IREERSGKTTFIAAHRMSAISHADVILVFDGGRIVEQGTHDELMQNGAWYKEQFDKQQM
FT                   EQQSQEQARQGVSS"
     MFAALKKLSW FFKQEKKRYI IAILILTVAS VLEIIPPRLI GFVVDDVHQG RMTEERLFGF        60
     VSFFIVLMLV VYVMTYVWMR KLFGGSLLLE RTMRSRLMNH LMTMTPSFYN RNKTGDLMAK       120
     GTNDLKAISQ TAGFGILTLV DATVFLVVIL VMMTVFISWE LTLAAFLPFP LMAYLMKVYG       180
     KRIHERFMAA QRAFGDLNDQ VLESISGVRV IRAFVKEQAD RTSFSKQTDH VLRQNIRVAR       240
     VDALFEPTIK ILVGMSYMIG LGFGAYLVFQ GRITLGQLVT FNIYLGMLIW PMFALGELMN       300
     IMQRGNASLD RLNHTFEAEP DVKDPDKPLR DLVPNEIVFD GLNFSYPKAK EPALSDVSVT       360
     IRKGMHIGVA GKTGSGKSTF LRQLLRAYPL HKGALKVNSV PFEQVSLSTV KGWIGYVPQE       420
     SFLFSKSIEA NIRFGAGDKV SDDRLRQVME QAAITKDLHT FQDGLETLVG EKGISLSGGQ       480
     KQRIAIARAL MKDPEILILD DAMSAVDAKT EQFIISNIRE ERSGKTTFIA AHRMSAISHA       540
     DVILVFDGGR IVEQGTHDEL MQNGAWYKEQ FDKQQMEQQS QEQARQGVSS                  590
//

If you have problems or comments...

PBIL Back to PBIL home page