(data stored in ACNUC7421 zone)

EMBL: CP001791.PE349

CP001791.PE349       Location/Qualifiers
FT   CDS             373971..376016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0361"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vfm:VFMJ11_1029 multidrug resistance ABC
FT                   transporter ATP-binding and permease protein; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97901"
FT                   /db_xref="GOA:D6XWQ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWQ9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97901.1"
FT                   /translation="MNKVKQEATPEPKETGKRLFQYAWPFRKTIFLSLFFLALAAAAEL
FT                   TGPFIAKTMIDEHIVGIEQTWVEVPDGDVTFEGRSFTREDRYAGDGTVDGVSIVQVGLD
FT                   YYLVEAREVTAGEETYENGVLTVVRDGETSVYPAVSMTTDDVFLFYAQEVPYIIGWMAL
FT                   YLVLIGISSFFHYYQSLWLQTSANRIIKQMREDVFRKVHELPVRYFDQMPTGKIVSRIT
FT                   NDTEAIRELYVRVLATFFTGIVYMIGIFFAIFLLDVRLALATLIIIPVLIVWMIVYRSF
FT                   AGRYNRVIREKLSDLNGRMNENIQGMSIIQAFGQEKKVADEFETHNDEHYRFNRKMLTL
FT                   NSLTSFNLIGLLRNVAFVTLIWYFAGGSMGVGMIFSLGVVYAFVDYINRLFEPINGIVG
FT                   QLAQLEEARIAGERVFHLMDQEGEPLPEAQTPRFHGDVTFDGVWLSYDEGHPVLRDISF
FT                   EAKKGETVAFVGHTGSGKSSIMNVLFRYYDHNQGRVLIDGQDTLALSRQDIRSHMAIVL
FT                   QDPFLFTGTIYSNVSMGDPAISRDQVMEALEQVGAGDFIRSLEAGIDEEVKEKGATFSA
FT                   GQRQLISFARALVVDPAILILDEATANIDTETEAVIQHALDVVKAGRTTFVIAHRLSTI
FT                   RDADQILVLSEGEIVEQGDHDELMAQRGRYHHMYQLQKGAGSGKVS"
     MNKVKQEATP EPKETGKRLF QYAWPFRKTI FLSLFFLALA AAAELTGPFI AKTMIDEHIV        60
     GIEQTWVEVP DGDVTFEGRS FTREDRYAGD GTVDGVSIVQ VGLDYYLVEA REVTAGEETY       120
     ENGVLTVVRD GETSVYPAVS MTTDDVFLFY AQEVPYIIGW MALYLVLIGI SSFFHYYQSL       180
     WLQTSANRII KQMREDVFRK VHELPVRYFD QMPTGKIVSR ITNDTEAIRE LYVRVLATFF       240
     TGIVYMIGIF FAIFLLDVRL ALATLIIIPV LIVWMIVYRS FAGRYNRVIR EKLSDLNGRM       300
     NENIQGMSII QAFGQEKKVA DEFETHNDEH YRFNRKMLTL NSLTSFNLIG LLRNVAFVTL       360
     IWYFAGGSMG VGMIFSLGVV YAFVDYINRL FEPINGIVGQ LAQLEEARIA GERVFHLMDQ       420
     EGEPLPEAQT PRFHGDVTFD GVWLSYDEGH PVLRDISFEA KKGETVAFVG HTGSGKSSIM       480
     NVLFRYYDHN QGRVLIDGQD TLALSRQDIR SHMAIVLQDP FLFTGTIYSN VSMGDPAISR       540
     DQVMEALEQV GAGDFIRSLE AGIDEEVKEK GATFSAGQRQ LISFARALVV DPAILILDEA       600
     TANIDTETEA VIQHALDVVK AGRTTFVIAH RLSTIRDADQ ILVLSEGEIV EQGDHDELMA       660
     QRGRYHHMYQ LQKGAGSGKV S                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page