(data stored in ACNUC7421 zone)

EMBL: CP001791.PE351

CP001791.PE351       Location/Qualifiers
FT   CDS             complement(377276..377851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0363"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: scl:sce3690
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97903"
FT                   /db_xref="GOA:D6XWR1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADH97903.1"
FT                   /translation="MPALETKAKELIFNTLSQSWAKSKHRRVVYHLKANDKILDIGAGK
FT                   GALSWMLLEQGFDVTPVDVQNISFTEKVKPVIYDGETLPFPDNSRDVGLFLTVLHHTPD
FT                   PEALIREALRVCDRLIIIEDVYHGKAQKYATWFTDSLFNLEFKGHPHTNKNNFGWLKTF
FT                   ADLDLRVLHIEKEPVLGLFEQVTYYVTK"
     MPALETKAKE LIFNTLSQSW AKSKHRRVVY HLKANDKILD IGAGKGALSW MLLEQGFDVT        60
     PVDVQNISFT EKVKPVIYDG ETLPFPDNSR DVGLFLTVLH HTPDPEALIR EALRVCDRLI       120
     IIEDVYHGKA QKYATWFTDS LFNLEFKGHP HTNKNNFGWL KTFADLDLRV LHIEKEPVLG       180
     LFEQVTYYVT K                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page