(data stored in ACNUC7421 zone)

EMBL: CP001791.PE354

CP001791.PE354       Location/Qualifiers
FT   CDS             complement(379933..381363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0366"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: vpa:VP0503 sodium/alanine symporter; TIGRFAM:
FT                   amino acid carrier protein; PFAM: sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97906"
FT                   /db_xref="GOA:D6XWR4"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR4"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ADH97906.1"
FT                   /translation="MEATLIHTIILDGVNSLVDWGNNLLWTYILIGLLIGLGVYFTFAT
FT                   KFVQFRLFKEMFRVITEKKDGTNGISPFQAFTISTASRVGTGNLTGVALAISIGGPGAV
FT                   FWMWMVAIIGMATAFIESTLAQVYKVRDGDQFRGGPAYYMEKAIGSRALGVVFAILLTL
FT                   CFGLVFNAVQANTIADAFDGAFGFNPLYMGIVIAAVAGIVIFGGVRRIARVTQIVVPFM
FT                   AVAYLLIATYVVITNFALIPDVFMLIVSNAFGVGEIIGGGVGAAIMQGVRRGLFSNEAG
FT                   MGSVPNAAATANVSHPAKQGLVQSLGVFFDTIIICSATAFLILLTDVYTVDGAEGIQLT
FT                   QDAMSAHVGEWAVYFVAIAILFFAFISIIGNYYYGETNIEFIRSNSNWLYAYRFAVIGM
FT                   VIFGSVAQVGLVWNLADLFMGLMAVLNLIAIFLIGKVALAVLNDYTTQLDSGKNPVFKA
FT                   SHIPDLKHAECWEDEQSS"
     MEATLIHTII LDGVNSLVDW GNNLLWTYIL IGLLIGLGVY FTFATKFVQF RLFKEMFRVI        60
     TEKKDGTNGI SPFQAFTIST ASRVGTGNLT GVALAISIGG PGAVFWMWMV AIIGMATAFI       120
     ESTLAQVYKV RDGDQFRGGP AYYMEKAIGS RALGVVFAIL LTLCFGLVFN AVQANTIADA       180
     FDGAFGFNPL YMGIVIAAVA GIVIFGGVRR IARVTQIVVP FMAVAYLLIA TYVVITNFAL       240
     IPDVFMLIVS NAFGVGEIIG GGVGAAIMQG VRRGLFSNEA GMGSVPNAAA TANVSHPAKQ       300
     GLVQSLGVFF DTIIICSATA FLILLTDVYT VDGAEGIQLT QDAMSAHVGE WAVYFVAIAI       360
     LFFAFISIIG NYYYGETNIE FIRSNSNWLY AYRFAVIGMV IFGSVAQVGL VWNLADLFMG       420
     LMAVLNLIAI FLIGKVALAV LNDYTTQLDS GKNPVFKASH IPDLKHAECW EDEQSS           476
//

If you have problems or comments...

PBIL Back to PBIL home page