(data stored in ACNUC7421 zone)

EMBL: CP001791.PE355

CP001791.PE355       Location/Qualifiers
FT   CDS             complement(381567..383396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0367"
FT                   /product="UbiD family decarboxylase"
FT                   /note="KEGG: gme:Gmet_0993 carboxylyase-like protein;
FT                   TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97907"
FT                   /db_xref="GOA:D6XWR5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR5"
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /protein_id="ADH97907.1"
FT                   /translation="MFENMKACIEDLEKHGHLLRIKEEVDPHLEMASIHLKTYAAGGPA
FT                   LYFENVKGSKYPAVSNLFGTLERSKFIFRHTLEGVQKVIALRDDPMYALKHPLQNVSSG
FT                   FSAVKALPMKKPAHAIHDTHDEIQIEDLPQIKSWPKDGGAFVTLPQVYSEDPDKPGPMN
FT                   ANLGMYRVQLSGNDYKMNEEVGIHYQIHRGIGIHQSKAAQRGEPLKVSIFVGGPPAHTI
FT                   ASVMPLPEGLSEILFAGLLSGRRFRHTYIDGYCVSLDADFVITGEIYPDETKPEGPFGD
FT                   HLGYYSLTHEFPVMRVHKVFARRDAVWPFTVVGRPPQEDTSFGDLIHELTGEAIKSEIP
FT                   GVQEVHAIDAAGVHPLLFVIGSERYTPFDEVDRPQELLTIANRVLGTNQLSLAKYLWIT
FT                   AEKDQPLDTHDEAGFMQYILERLELRRDLHFQTKTTIDTLDYSGEGLNEGSKVVLAAYG
FT                   KQRRELAKVIPDSLKDVTAPFTNANLVMPGIVAVEGPAYGHADKAKTDMETLSKSLSAA
FT                   RDLDGVPMIVVVDDASFTSATLNNFVWVTFTRSNPSHDMYGVNEAIVNKHWGCDAMIID
FT                   ARRKPHHAPPLIADPETEQNVAAFFDRMAKGEY"
     MFENMKACIE DLEKHGHLLR IKEEVDPHLE MASIHLKTYA AGGPALYFEN VKGSKYPAVS        60
     NLFGTLERSK FIFRHTLEGV QKVIALRDDP MYALKHPLQN VSSGFSAVKA LPMKKPAHAI       120
     HDTHDEIQIE DLPQIKSWPK DGGAFVTLPQ VYSEDPDKPG PMNANLGMYR VQLSGNDYKM       180
     NEEVGIHYQI HRGIGIHQSK AAQRGEPLKV SIFVGGPPAH TIASVMPLPE GLSEILFAGL       240
     LSGRRFRHTY IDGYCVSLDA DFVITGEIYP DETKPEGPFG DHLGYYSLTH EFPVMRVHKV       300
     FARRDAVWPF TVVGRPPQED TSFGDLIHEL TGEAIKSEIP GVQEVHAIDA AGVHPLLFVI       360
     GSERYTPFDE VDRPQELLTI ANRVLGTNQL SLAKYLWITA EKDQPLDTHD EAGFMQYILE       420
     RLELRRDLHF QTKTTIDTLD YSGEGLNEGS KVVLAAYGKQ RRELAKVIPD SLKDVTAPFT       480
     NANLVMPGIV AVEGPAYGHA DKAKTDMETL SKSLSAARDL DGVPMIVVVD DASFTSATLN       540
     NFVWVTFTRS NPSHDMYGVN EAIVNKHWGC DAMIIDARRK PHHAPPLIAD PETEQNVAAF       600
     FDRMAKGEY                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page