(data stored in ACNUC7421 zone)

EMBL: CP001791.PE356

CP001791.PE356       Location/Qualifiers
FT   CDS             383591..384643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0368"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; protein of unknown
FT                   function DUF59; KEGG: mca:MCA0052 mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97908"
FT                   /db_xref="GOA:D6XWR6"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR6"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADH97908.1"
FT                   /translation="MLTEQQVLDALKPIKDPHLGVGLLDLDSVKDLKIKENLVSLKLAI
FT                   AEPGTAEQMQLQQEVVNAVKTAGAESVGLRFEKLPDEVLAEHGGQSEEAASESLLDRTD
FT                   RTTFIAVTSGKGGVGKSTVSVNLATSLARQGKKVGIIDADIYGFSVPDMMGIEERPKVV
FT                   GQRIYPVTRFDVQVISMGFFVEDNSPIIWRGPMLGKMLNNFFSEVEWDDLDYLILDLPP
FT                   GTGDVALDVHSMLPTSKEIVVTTPHATAAFVAARAGAMALKTDHEILGVVENMAYFESK
FT                   VTGEKEYVFGTGGGQKLAEELHSEVLAQIPLGQPDFDEEVFAPSVYDQEHPIGKIYMDM
FT                   AKQVIEKTAK"
     MLTEQQVLDA LKPIKDPHLG VGLLDLDSVK DLKIKENLVS LKLAIAEPGT AEQMQLQQEV        60
     VNAVKTAGAE SVGLRFEKLP DEVLAEHGGQ SEEAASESLL DRTDRTTFIA VTSGKGGVGK       120
     STVSVNLATS LARQGKKVGI IDADIYGFSV PDMMGIEERP KVVGQRIYPV TRFDVQVISM       180
     GFFVEDNSPI IWRGPMLGKM LNNFFSEVEW DDLDYLILDL PPGTGDVALD VHSMLPTSKE       240
     IVVTTPHATA AFVAARAGAM ALKTDHEILG VVENMAYFES KVTGEKEYVF GTGGGQKLAE       300
     ELHSEVLAQI PLGQPDFDEE VFAPSVYDQE HPIGKIYMDM AKQVIEKTAK                  350
//

If you have problems or comments...

PBIL Back to PBIL home page