(data stored in ACNUC7421 zone)

EMBL: CP001791.PE357

CP001791.PE357       Location/Qualifiers
FT   CDS             384774..385445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97909"
FT                   /db_xref="GOA:D6XWR7"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97909.1"
FT                   /translation="MAVNARKVVFLFWSTLLIGTVAGTIIGLIQGIGGYFMVIVTAALW
FT                   TVIAQMGFFAYLTIHRFGLGMFKSVSLWNKVQLVIIAFAFFDLMFFRHYFFATDDETML
FT                   GYAIMPTLLLVYALIVAYLKAKDTNRHAFIPALFFMYVVTMIEWIPAFTGNDLNFIINA
FT                   VVPLLVANTWQLLVLHRLHEMPNGRQPTVEQWSKWEKEGFEERKREKETKKNRKKARKN
FT                   A"
     MAVNARKVVF LFWSTLLIGT VAGTIIGLIQ GIGGYFMVIV TAALWTVIAQ MGFFAYLTIH        60
     RFGLGMFKSV SLWNKVQLVI IAFAFFDLMF FRHYFFATDD ETMLGYAIMP TLLLVYALIV       120
     AYLKAKDTNR HAFIPALFFM YVVTMIEWIP AFTGNDLNFI INAVVPLLVA NTWQLLVLHR       180
     LHEMPNGRQP TVEQWSKWEK EGFEERKREK ETKKNRKKAR KNA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page