(data stored in ACNUC7421 zone)

EMBL: CP001791.PE360

CP001791.PE360       Location/Qualifiers
FT   CDS             387688..388506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0372"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   pca:Pcar_0999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97912"
FT                   /db_xref="GOA:D6XWS0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:D6XWS0"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADH97912.1"
FT                   /translation="MFEDLTFWRLVAIVVDITLVAFVIYKLIMVIRGTRAVQLVKGITV
FT                   ILTVWFLSGYFGLHTLQWLMQQAVIYGVLAIIIIFQPELRRALEHLGRGKLFQSSSTAN
FT                   AEEIEEMIEHLIKSTNYMGKRRIGALISIERETGMNDYIETGVKLNANLTTELMTNIFI
FT                   PNAPLHDGAVVLQNGSIAAAGCYLPLSENPFISKELGTRHRAALGVSEVTDALTLVVSE
FT                   ETGAISMTKNGELHRNLDQDHLRKMLEKELMNKEEDKGTSRWQWGGRNNG"
     MFEDLTFWRL VAIVVDITLV AFVIYKLIMV IRGTRAVQLV KGITVILTVW FLSGYFGLHT        60
     LQWLMQQAVI YGVLAIIIIF QPELRRALEH LGRGKLFQSS STANAEEIEE MIEHLIKSTN       120
     YMGKRRIGAL ISIERETGMN DYIETGVKLN ANLTTELMTN IFIPNAPLHD GAVVLQNGSI       180
     AAAGCYLPLS ENPFISKELG TRHRAALGVS EVTDALTLVV SEETGAISMT KNGELHRNLD       240
     QDHLRKMLEK ELMNKEEDKG TSRWQWGGRN NG                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page