(data stored in ACNUC7421 zone)

EMBL: CP001791.PE362

CP001791.PE362       Location/Qualifiers
FT   CDS             389901..391262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0374"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="KEGG: pca:Pcar_1001 phosphohexomutase; TIGRFAM:
FT                   phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97914"
FT                   /db_xref="GOA:D6XX57"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX57"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADH97914.1"
FT                   /translation="MGKFFGTDGVRGIANKELTPELAFKLGRFGGYVLTKETEKPKILI
FT                   GRDPRISGPMLESALIAGLLSMGAEVMRLGVITTPGVAYLTKALSADAGVMISASHNPV
FT                   EDNGIKFFGPDGFKLVDEQEEEIERLLHQEDDMEDDLPRPVGGEIGTVSDYFEGGQKYL
FT                   RFLKQTLSEDFSGLKIAIDCAHGAASSLANHLFADLEAEDIFCIGSSPNGVNINAGVGS
FT                   THPEGLVDLVKEKGADIGLAFDGDADRLIAVDEKGNIVDGDQIMYITAKYLRDNGRLVD
FT                   DTVVSTVMSNLGFYKALEEAGIQTKQTAVGDRYVMEEMRKGNYSLGGEQSGHIIFLEHS
FT                   TTGDGLLSGIQLVQIMKATGKTLSELASEWSHYPQKLVNVRVADKHALHNNDVIADEIR
FT                   AVEQGMNGEGRILVRPSGTEPLVRVMAEAPSREKCEEIVDGIVGVVKRELGSIE"
     MGKFFGTDGV RGIANKELTP ELAFKLGRFG GYVLTKETEK PKILIGRDPR ISGPMLESAL        60
     IAGLLSMGAE VMRLGVITTP GVAYLTKALS ADAGVMISAS HNPVEDNGIK FFGPDGFKLV       120
     DEQEEEIERL LHQEDDMEDD LPRPVGGEIG TVSDYFEGGQ KYLRFLKQTL SEDFSGLKIA       180
     IDCAHGAASS LANHLFADLE AEDIFCIGSS PNGVNINAGV GSTHPEGLVD LVKEKGADIG       240
     LAFDGDADRL IAVDEKGNIV DGDQIMYITA KYLRDNGRLV DDTVVSTVMS NLGFYKALEE       300
     AGIQTKQTAV GDRYVMEEMR KGNYSLGGEQ SGHIIFLEHS TTGDGLLSGI QLVQIMKATG       360
     KTLSELASEW SHYPQKLVNV RVADKHALHN NDVIADEIRA VEQGMNGEGR ILVRPSGTEP       420
     LVRVMAEAPS REKCEEIVDG IVGVVKRELG SIE                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page