(data stored in ACNUC7421 zone)

EMBL: CP001791.PE363

CP001791.PE363       Location/Qualifiers
FT   CDS             391399..391773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0375"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: vha:VIBHAR_07005 hypothetical protein; PFAM:
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97915"
FT                   /db_xref="GOA:D6XX58"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX58"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH97915.1"
FT                   /translation="MVNFHDKKPIYLQIKEKIETLIVHDQLRPGERIPSTNELVQLYKV
FT                   NHLTVAKGINLLVEEGLVYKKRGVGMFVEEGAKETVQGTRKEAFKEDYLLPMLEEAEKI
FT                   GMSEEEIIHMIRIWKERDGQ"
     MVNFHDKKPI YLQIKEKIET LIVHDQLRPG ERIPSTNELV QLYKVNHLTV AKGINLLVEE        60
     GLVYKKRGVG MFVEEGAKET VQGTRKEAFK EDYLLPMLEE AEKIGMSEEE IIHMIRIWKE       120
     RDGQ                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page