(data stored in ACNUC7421 zone)

EMBL: CP001791.PE364

CP001791.PE364       Location/Qualifiers
FT   CDS             391770..392636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0376"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sde:Sde_3524 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97916"
FT                   /db_xref="GOA:D6XX59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX59"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97916.1"
FT                   /translation="MIEVEGLTHRFKKESALQDISFAMEKGRTYGLIGRNGAGKTTLLS
FT                   ILASFLPKQEGTYRYKGEDPFEQQALMREIQFVYQRDYSDETDKVTDYVKLYGRYLPRF
FT                   DEERALSLLKGFGVPLDKAIHSLSTGKQSAFTICLGLASQSEVLIFDEAYQGLDAPGRE
FT                   RFYQLLVEEQERDPKLIILSTHLVSEMDYLFDHVLILDRGELVVNEPAEAFRDRGVTVT
FT                   GHKDTIAAFVEGKQVIQRRELGPTVACTLFDRPDEEELREMKEAGIEISAVSLQDLFIF
FT                   MTEEEEV"
     MIEVEGLTHR FKKESALQDI SFAMEKGRTY GLIGRNGAGK TTLLSILASF LPKQEGTYRY        60
     KGEDPFEQQA LMREIQFVYQ RDYSDETDKV TDYVKLYGRY LPRFDEERAL SLLKGFGVPL       120
     DKAIHSLSTG KQSAFTICLG LASQSEVLIF DEAYQGLDAP GRERFYQLLV EEQERDPKLI       180
     ILSTHLVSEM DYLFDHVLIL DRGELVVNEP AEAFRDRGVT VTGHKDTIAA FVEGKQVIQR       240
     RELGPTVACT LFDRPDEEEL REMKEAGIEI SAVSLQDLFI FMTEEEEV                    288
//

If you have problems or comments...

PBIL Back to PBIL home page