(data stored in ACNUC7421 zone)

EMBL: CP001791.PE365

CP001791.PE365       Location/Qualifiers
FT   CDS             392633..393361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97917"
FT                   /db_xref="GOA:D6XX60"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97917.1"
FT                   /translation="MSSVNTAIQKKVGVDLFSMQMRWAYWLIGVVWFLYLTGSFFSGTL
FT                   QDFILLHFMDSLFQPAKIFMFVIGIISGVYLMPLFVQLGVTRRNYFIGATVATFLVSGV
FT                   IMLFGMLLHTVTMGLTAVTPLTAGGGVVDFLPDELFLGWRFVIFTLIAAVYYGTGWLIA
FT                   IGFYRFKTWVGMLTIPAAIFFNVITELFWDSGLNIWLFFWIEADFSGSLPVSFVATVLI
FT                   LGVLYGIIRKLTADVAIKVK"
     MSSVNTAIQK KVGVDLFSMQ MRWAYWLIGV VWFLYLTGSF FSGTLQDFIL LHFMDSLFQP        60
     AKIFMFVIGI ISGVYLMPLF VQLGVTRRNY FIGATVATFL VSGVIMLFGM LLHTVTMGLT       120
     AVTPLTAGGG VVDFLPDELF LGWRFVIFTL IAAVYYGTGW LIAIGFYRFK TWVGMLTIPA       180
     AIFFNVITEL FWDSGLNIWL FFWIEADFSG SLPVSFVATV LILGVLYGII RKLTADVAIK       240
     VK                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page