(data stored in ACNUC7421 zone)

EMBL: CP001791.PE366

CP001791.PE366       Location/Qualifiers
FT   CDS             393868..395673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0378"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: gbm:Gbem_0090
FT                   glucosamine--fructose-6-phosphate aminotransferase,
FT                   isomerizing; TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97918"
FT                   /db_xref="GOA:D6XX61"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX61"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADH97918.1"
FT                   /translation="MCGIVGYAGTAAANEILLKGLERLEYRGYDSAGIALVNGDGVHVY
FT                   KEKGRIAILRDSMDQAQPGPVGIGHTRWATHGAPSQVNAHPHQSRSGRFTLVHNGVIEN
FT                   YEYVQREYLADVEMVSDTDTEIIVQLIEKFANEDGMQTEEAFRKTLSLLKGSYATALLD
FT                   ELNPETIYVGKNKSPLLVGLADGVNVVASDAMAMLQVTNEFVEIMDGEMVIVTRDDVQI
FT                   KSVDGDTVTRDSYIAEIDSTDIEKGTYPHFMLKEIEEQPFTMRNIITKYKDENENIKLD
FT                   EHIRQAVLDADRIYIIAAGTSFNAGLVGKEMIEKIAQIPVETHIASEFLYNMPILSQNP
FT                   LFIFISQSGETADCRGVLVNVKELGHKTLTITNVPGSTLSREADYTLHTYAGPEIAVAS
FT                   TKAYTAQMAVLAILSVDTARAKGIEIDFDPMQQLGIVANAMDIFMEKKDELEQMARDYL
FT                   SVTRNCFYIGRGMDYHVCMEASLKLKEISYIQAEGFAGGELKHGTIALIEEGTPVVGLA
FT                   TQESVHLNLRGNMKEVVARGANPLMISMEGFEEADDKIVIPRVHELFTPLVSVIPMQFI
FT                   AYYAALHRGCDVDKPRNLAKSVTVE"
     MCGIVGYAGT AAANEILLKG LERLEYRGYD SAGIALVNGD GVHVYKEKGR IAILRDSMDQ        60
     AQPGPVGIGH TRWATHGAPS QVNAHPHQSR SGRFTLVHNG VIENYEYVQR EYLADVEMVS       120
     DTDTEIIVQL IEKFANEDGM QTEEAFRKTL SLLKGSYATA LLDELNPETI YVGKNKSPLL       180
     VGLADGVNVV ASDAMAMLQV TNEFVEIMDG EMVIVTRDDV QIKSVDGDTV TRDSYIAEID       240
     STDIEKGTYP HFMLKEIEEQ PFTMRNIITK YKDENENIKL DEHIRQAVLD ADRIYIIAAG       300
     TSFNAGLVGK EMIEKIAQIP VETHIASEFL YNMPILSQNP LFIFISQSGE TADCRGVLVN       360
     VKELGHKTLT ITNVPGSTLS READYTLHTY AGPEIAVAST KAYTAQMAVL AILSVDTARA       420
     KGIEIDFDPM QQLGIVANAM DIFMEKKDEL EQMARDYLSV TRNCFYIGRG MDYHVCMEAS       480
     LKLKEISYIQ AEGFAGGELK HGTIALIEEG TPVVGLATQE SVHLNLRGNM KEVVARGANP       540
     LMISMEGFEE ADDKIVIPRV HELFTPLVSV IPMQFIAYYA ALHRGCDVDK PRNLAKSVTV       600
     E                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page