(data stored in ACNUC7421 zone)

EMBL: CP001791.PE368

CP001791.PE368       Location/Qualifiers
FT   CDS             396964..397491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97920"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97920.1"
FT                   /translation="MKRWTLGLFLIALTGCAANAEDPSYVIATLDGETITMEDYFFRYT
FT                   DPSMIEEYLKERVMIKEAEDLGITVSEDEVNASRQMLFPDSDAEERLAFWEDRAFIDEQ
FT                   AERLDMDELAYFKEWEEKMYRSQLFVDAYVEEVFGGFPEDTDEMQALGEEIDAHIDTLF
FT                   DTYQEEYRLEME"
     MKRWTLGLFL IALTGCAANA EDPSYVIATL DGETITMEDY FFRYTDPSMI EEYLKERVMI        60
     KEAEDLGITV SEDEVNASRQ MLFPDSDAEE RLAFWEDRAF IDEQAERLDM DELAYFKEWE       120
     EKMYRSQLFV DAYVEEVFGG FPEDTDEMQA LGEEIDAHID TLFDTYQEEY RLEME            175
//

If you have problems or comments...

PBIL Back to PBIL home page