(data stored in ACNUC7421 zone)

EMBL: CP001791.PE37

CP001791.PE37        Location/Qualifiers
FT   CDS             48140..48508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0038"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97589"
FT                   /db_xref="GOA:D6XV31"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV31"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ADH97589.1"
FT                   /translation="MNKNELFARVGQMEEQIGGLHRDLGELKNQLAEMLEENTHLQLEN
FT                   EHLRERLMNELTEKEPDRQAAAGEAPAVKQNVTPGFGEGYDNLARLYQEGFHICNLHYG
FT                   SIRKEGDCLFCLSFLNKK"
     MNKNELFARV GQMEEQIGGL HRDLGELKNQ LAEMLEENTH LQLENEHLRE RLMNELTEKE        60
     PDRQAAAGEA PAVKQNVTPG FGEGYDNLAR LYQEGFHICN LHYGSIRKEG DCLFCLSFLN       120
     KK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page