(data stored in ACNUC7421 zone)

EMBL: CP001791.PE370

CP001791.PE370       Location/Qualifiers
FT   CDS             complement(397808..399322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0382"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: AbgT putative transporter; short chain fatty
FT                   acid transporter; KEGG: ppr:PBPRA0142 putative efflux pump
FT                   component MtrF"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97922"
FT                   /db_xref="GOA:D6XX65"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX65"
FT                   /inference="protein motif:PFAM:PF03806"
FT                   /protein_id="ADH97922.1"
FT                   /translation="MPQQKRGLFQRFLDMIEVAGNKLPHPVTLFAILTFIVIALSGILS
FT                   GISVEHPGEEGEMVQITNLMNAEGLQYMLSSMVDNFIGFAPLGVVLATMLGIGLAERTG
FT                   LISACLRGFVLSIPNVLITAGLVFAGIMSSVASDAGYVVLPPLGAVIFAALGRHPLAGL
FT                   AAAFAGVSAGFSANLLLSATDPMLGEMTIEAAAIVDPAYAEGMNIAMNYYFIAASVFML
FT                   TIVGAWVTEKIVEPRLGKYEGDYREELKGLDPIEKKGLRWAGLSLLIGIVLVLLTIVPA
FT                   NGPLRADDGQIIQSPFMDALVPIIAILFFIPGLFYGMATKNIKNDKDVANQLSDTMAAM
FT                   GMFIVLAFTAGQFVAYFGETNMGLVLGVYGAELLEAANLTGIPLILGFIFVAGFINLFI
FT                   GSASAKWAMMAPVFVPIMMHLGYSPEMTQMAYRIADSTTNIITPLMTYFAIIIAFAQKY
FT                   DKKMGIGTMISVMFPYSIIFMITWTIMLIVWMLLGIDLGPGSPITY"
     MPQQKRGLFQ RFLDMIEVAG NKLPHPVTLF AILTFIVIAL SGILSGISVE HPGEEGEMVQ        60
     ITNLMNAEGL QYMLSSMVDN FIGFAPLGVV LATMLGIGLA ERTGLISACL RGFVLSIPNV       120
     LITAGLVFAG IMSSVASDAG YVVLPPLGAV IFAALGRHPL AGLAAAFAGV SAGFSANLLL       180
     SATDPMLGEM TIEAAAIVDP AYAEGMNIAM NYYFIAASVF MLTIVGAWVT EKIVEPRLGK       240
     YEGDYREELK GLDPIEKKGL RWAGLSLLIG IVLVLLTIVP ANGPLRADDG QIIQSPFMDA       300
     LVPIIAILFF IPGLFYGMAT KNIKNDKDVA NQLSDTMAAM GMFIVLAFTA GQFVAYFGET       360
     NMGLVLGVYG AELLEAANLT GIPLILGFIF VAGFINLFIG SASAKWAMMA PVFVPIMMHL       420
     GYSPEMTQMA YRIADSTTNI ITPLMTYFAI IIAFAQKYDK KMGIGTMISV MFPYSIIFMI       480
     TWTIMLIVWM LLGIDLGPGS PITY                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page