(data stored in ACNUC7421 zone)

EMBL: CP001791.PE371

CP001791.PE371       Location/Qualifiers
FT   CDS             complement(399484..400329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0383"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: dal:Dalk_5022 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97923"
FT                   /db_xref="GOA:D6XX66"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX66"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADH97923.1"
FT                   /translation="MALFLGLITAMAFGIGDFLAGQVTRRVPTLIVVLYAQLFGTVMML
FT                   IVASLTGFHMSLSSFWWGGLGGIAIGFGFLFYFKALAMGKMGVVSSVTGTLSAVVPVLT
FT                   GLFLGERPGTFALVAVGIIMIAIVLISKKEVEGDAEDGDGQKVLSFAAMAGFLIGLYFV
FT                   FLHIPPETESMWTVFFTMAGSFLAVSSVLLFRRADFLTLNRTGLGYIFGNGFLQAFGTI
FT                   TYILGVSIGLLSIVALAGALSPLFTVLCAWLFIKEMLTVPQKWGITLALTGVVLLVLST
FT                   "
     MALFLGLITA MAFGIGDFLA GQVTRRVPTL IVVLYAQLFG TVMMLIVASL TGFHMSLSSF        60
     WWGGLGGIAI GFGFLFYFKA LAMGKMGVVS SVTGTLSAVV PVLTGLFLGE RPGTFALVAV       120
     GIIMIAIVLI SKKEVEGDAE DGDGQKVLSF AAMAGFLIGL YFVFLHIPPE TESMWTVFFT       180
     MAGSFLAVSS VLLFRRADFL TLNRTGLGYI FGNGFLQAFG TITYILGVSI GLLSIVALAG       240
     ALSPLFTVLC AWLFIKEMLT VPQKWGITLA LTGVVLLVLS T                           281
//

If you have problems or comments...

PBIL Back to PBIL home page