(data stored in ACNUC7421 zone)

EMBL: CP001791.PE375

CP001791.PE375       Location/Qualifiers
FT   CDS             404378..405109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97927"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97927.1"
FT                   /translation="MAVIWEHKWKILLGVALAITAIIWLLLRSYPAGSLADDAMAGEWS
FT                   DVKDENGAIRFIAEGEPLGHVMYYPGGLVRPESYSYLASQLAEAGVETWVIPMPLNLAV
FT                   LGISRGEQALGLIGGSPVVIGGHSLGGAMAARFAKDHEDQLDGVFFHGAYPDEGGRLDG
FT                   TSLSVLSIQMEEDRVLNSESYEEGLGYMPDAFFEEWIEGGNHASFGDYGPQRGDGEATI
FT                   SHEEAVEQIVDLTVDWLESLQ"
     MAVIWEHKWK ILLGVALAIT AIIWLLLRSY PAGSLADDAM AGEWSDVKDE NGAIRFIAEG        60
     EPLGHVMYYP GGLVRPESYS YLASQLAEAG VETWVIPMPL NLAVLGISRG EQALGLIGGS       120
     PVVIGGHSLG GAMAARFAKD HEDQLDGVFF HGAYPDEGGR LDGTSLSVLS IQMEEDRVLN       180
     SESYEEGLGY MPDAFFEEWI EGGNHASFGD YGPQRGDGEA TISHEEAVEQ IVDLTVDWLE       240
     SLQ                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page