(data stored in ACNUC7421 zone)

EMBL: CP001791.PE376

CP001791.PE376       Location/Qualifiers
FT   CDS             complement(405189..406739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0388"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="KEGG: azo:azo0770 alkyl hydroperoxide reductase
FT                   subunit F; TIGRFAM: alkyl hydroperoxide reductase, F
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97928"
FT                   /db_xref="GOA:D6XX71"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX71"
FT                   /inference="protein motif:TFAM:TIGR03140"
FT                   /protein_id="ADH97928.1"
FT                   /translation="MVLDNAITQQLKQYLDLLEGDLTFKLDAGSDANSDKLAGFVREVA
FT                   SMSPRITVEEASLARTPSFTVTRTGENTGVTFAGVPLGHEFTSFVLAILQVSGRPPKVE
FT                   EETLNQMKQLEGDFTFETYVSLSCQNCPEVVQALNMLSAVNPGVTNTMIDGAAFKDEVE
FT                   ARDVMAVPAVYLNGEFLGGGRMTIEDILEKLGQGTDASELDAKDPFDVLVVGGGPAGAS
FT                   AAVYASRKGIRTGVVAERFGGQVQDTMSIENFISVKKTEGPKLVASLEEHVRDYSVDIM
FT                   KSQRVKAVDKKDLFEVTLENGAVLKSKSVILSTGARWRNVGVPGEEAFKNNGVAYCPHC
FT                   DGPLFEGKDVSVIGGGNSGVEAAIDLAGIVNHVYLLEFMPELKADEVLQKKLHSLPNVT
FT                   VITNAQTTEITGDKKVNGISYKDRVTEEDRHIPLQGVFVQIGLVPNTEFLDDSIETTRM
FT                   GEIVVDQHGATNVPGLFAAGDCTNTPYKQIIISMGSGATASLGAFDYLIRSEEPVVSV"
     MVLDNAITQQ LKQYLDLLEG DLTFKLDAGS DANSDKLAGF VREVASMSPR ITVEEASLAR        60
     TPSFTVTRTG ENTGVTFAGV PLGHEFTSFV LAILQVSGRP PKVEEETLNQ MKQLEGDFTF       120
     ETYVSLSCQN CPEVVQALNM LSAVNPGVTN TMIDGAAFKD EVEARDVMAV PAVYLNGEFL       180
     GGGRMTIEDI LEKLGQGTDA SELDAKDPFD VLVVGGGPAG ASAAVYASRK GIRTGVVAER       240
     FGGQVQDTMS IENFISVKKT EGPKLVASLE EHVRDYSVDI MKSQRVKAVD KKDLFEVTLE       300
     NGAVLKSKSV ILSTGARWRN VGVPGEEAFK NNGVAYCPHC DGPLFEGKDV SVIGGGNSGV       360
     EAAIDLAGIV NHVYLLEFMP ELKADEVLQK KLHSLPNVTV ITNAQTTEIT GDKKVNGISY       420
     KDRVTEEDRH IPLQGVFVQI GLVPNTEFLD DSIETTRMGE IVVDQHGATN VPGLFAAGDC       480
     TNTPYKQIII SMGSGATASL GAFDYLIRSE EPVVSV                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page