(data stored in ACNUC7421 zone)

EMBL: CP001791.PE379

CP001791.PE379       Location/Qualifiers
FT   CDS             complement(408205..409398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97931"
FT                   /db_xref="InterPro:IPR025466"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97931.1"
FT                   /translation="MNKKDIAHIKKQFKPNNDLMTISDIFNVYIMKDTSEIYHYEAMPF
FT                   DLLEDEQKELFLANFKKVLTGQADEKLFELKFRRDVSNSTQMILHQGLLSAETESWTDE
FT                   MLKIVAKMLHEKTYEMDLVITFIRGTYMKPVKQSADITSEESDRDSVYAHGFILCSINK
FT                   TEDPKKELLFDYVEKEFKYNILVDPVINLKAPISGFLFPCFNDGAADVNHVLYAAGKAH
FT                   EPNYPFIEDVLNAEEVTTAQEDKIIFEEIVKSAVGKPMSTSTLSNVYEEINRVVEENED
FT                   DEPPRLDSKDVEDVLRISGVEDVDTEKVEAAFEEIVDDRQYAFKATSVMPKYQSKSIKI
FT                   KTKAADLSVSPEDLRFLRQVEIDGRIYLMLEVPEAARIEGFDMIPEALFTKVESEED"
     MNKKDIAHIK KQFKPNNDLM TISDIFNVYI MKDTSEIYHY EAMPFDLLED EQKELFLANF        60
     KKVLTGQADE KLFELKFRRD VSNSTQMILH QGLLSAETES WTDEMLKIVA KMLHEKTYEM       120
     DLVITFIRGT YMKPVKQSAD ITSEESDRDS VYAHGFILCS INKTEDPKKE LLFDYVEKEF       180
     KYNILVDPVI NLKAPISGFL FPCFNDGAAD VNHVLYAAGK AHEPNYPFIE DVLNAEEVTT       240
     AQEDKIIFEE IVKSAVGKPM STSTLSNVYE EINRVVEENE DDEPPRLDSK DVEDVLRISG       300
     VEDVDTEKVE AAFEEIVDDR QYAFKATSVM PKYQSKSIKI KTKAADLSVS PEDLRFLRQV       360
     EIDGRIYLML EVPEAARIEG FDMIPEALFT KVESEED                                397
//

If you have problems or comments...

PBIL Back to PBIL home page