(data stored in ACNUC7421 zone)

EMBL: CP001791.PE381

CP001791.PE381       Location/Qualifiers
FT   CDS             complement(410001..410582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0393"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: apa:APP7_0893
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97933"
FT                   /db_xref="GOA:D6XX76"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX76"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH97933.1"
FT                   /translation="MSRRTDRRVQYTRSVIEESFLTLLEQKPLHSITVKALCSEADINR
FT                   STFYSHYKDIHDLLEGIQKRIMEDVEAMLNAFDYTKDDEALAMTTSLMRYLKENRRNSR
FT                   IIFSDHGDPDFQRRVIYRVHRHLLQSFFRDHVKDTPINPDHLSTFVIHGSIAVVHSWVR
FT                   NNMEESPEVIAWMIANFTNHGISAVGLQTP"
     MSRRTDRRVQ YTRSVIEESF LTLLEQKPLH SITVKALCSE ADINRSTFYS HYKDIHDLLE        60
     GIQKRIMEDV EAMLNAFDYT KDDEALAMTT SLMRYLKENR RNSRIIFSDH GDPDFQRRVI       120
     YRVHRHLLQS FFRDHVKDTP INPDHLSTFV IHGSIAVVHS WVRNNMEESP EVIAWMIANF       180
     TNHGISAVGL QTP                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page