(data stored in ACNUC7421 zone)

EMBL: CP001791.PE382

CP001791.PE382       Location/Qualifiers
FT   CDS             410721..412781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0394"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: cja:CJA_3753 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97934"
FT                   /db_xref="GOA:D6XX77"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX77"
FT                   /inference="protein motif:COG:COG1033"
FT                   /protein_id="ADH97934.1"
FT                   /translation="MQKFTEIITHYHKSVVLVFMALTILSAVMIPFVTVNYNINDYLPE
FT                   DSPSMVAVDVLEEEFGSPMQNARVMIEDVSVQEALTYKDRLEAIEGVSDVTWLDDVVDL
FT                   RTPLELVDEGMLETYYQDRYAIIEMTIQEGEELAITDEIYELIGEENALVGDAIDTAVS
FT                   QQMAFTETLFAALLLVPIIIIILILSTTSWVEPLFFLTAIGVSVLINLGTNIFIGEVSF
FT                   VTNSVAPILQLAVALDYAIFLLHSFSDQRKTDSNPVTAMQKAVRQSFPAIAASAATTFF
FT                   GFMALAVMEFEIGADLGLNLVKGIALSFISVVVFLPALTVWLFKWIDKTQHKPMFPQFR
FT                   NVGKRVVKVRYFSIVLVALIIFPAYLAQQETSFIYGIGEQPEDTRLGADEVKVNEVFGQ
FT                   STPIVLLVPRGDVPRELSLEQDLLAIPEVDSIMSYNELIGSMIPQEHLDESMTEAFLSE
FT                   NYSQLILYTETESEGDEAFAVVEEVKSYAGAYYGDGFHALGESVSLYDIKDIVLDDNRA
FT                   VNIMTVIAIGAVIMVTFRSLLLPVILLVTIQSSVWINLAVPYVTDTPLVYIGYLVVGTV
FT                   QLAATVDYAILFTENFMENRKRMPARAAIIDTVNNKTFSISISAAILSSVGFILFLTST
FT                   NPIIGSIGLLIGRGALLAFLMVLFLLPAILLVGDRLVEKLTYKTDFYKERD"
     MQKFTEIITH YHKSVVLVFM ALTILSAVMI PFVTVNYNIN DYLPEDSPSM VAVDVLEEEF        60
     GSPMQNARVM IEDVSVQEAL TYKDRLEAIE GVSDVTWLDD VVDLRTPLEL VDEGMLETYY       120
     QDRYAIIEMT IQEGEELAIT DEIYELIGEE NALVGDAIDT AVSQQMAFTE TLFAALLLVP       180
     IIIIILILST TSWVEPLFFL TAIGVSVLIN LGTNIFIGEV SFVTNSVAPI LQLAVALDYA       240
     IFLLHSFSDQ RKTDSNPVTA MQKAVRQSFP AIAASAATTF FGFMALAVME FEIGADLGLN       300
     LVKGIALSFI SVVVFLPALT VWLFKWIDKT QHKPMFPQFR NVGKRVVKVR YFSIVLVALI       360
     IFPAYLAQQE TSFIYGIGEQ PEDTRLGADE VKVNEVFGQS TPIVLLVPRG DVPRELSLEQ       420
     DLLAIPEVDS IMSYNELIGS MIPQEHLDES MTEAFLSENY SQLILYTETE SEGDEAFAVV       480
     EEVKSYAGAY YGDGFHALGE SVSLYDIKDI VLDDNRAVNI MTVIAIGAVI MVTFRSLLLP       540
     VILLVTIQSS VWINLAVPYV TDTPLVYIGY LVVGTVQLAA TVDYAILFTE NFMENRKRMP       600
     ARAAIIDTVN NKTFSISISA AILSSVGFIL FLTSTNPIIG SIGLLIGRGA LLAFLMVLFL       660
     LPAILLVGDR LVEKLTYKTD FYKERD                                            686
//

If you have problems or comments...

PBIL Back to PBIL home page