(data stored in ACNUC7421 zone)

EMBL: CP001791.PE383

CP001791.PE383       Location/Qualifiers
FT   CDS             412784..414625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0395"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: Axoneme-associated protein GASP-180"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97935"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX78"
FT                   /inference="protein motif:COG:COG1511"
FT                   /protein_id="ADH97935.1"
FT                   /translation="MNKWTAGLLAALILPPVYIGFADDTAHDNETPETSGTDGEVASKE
FT                   EVIYGNLNHDGSVTDLYVVNMLDVTSAGRIVDYGNYDSVQNLTSLAEIQIDGDEISAEA
FT                   EEGWFYYQGNKDGATLPWAMDITYTLDGEEVDAGDLAGADGHLHLSLTTEANDGVNPSF
FT                   YENYTLQVSVSFDASVAGNIHAPDATVANAGKERQLSYTVMPETDGDIEFFADVTDFEM
FT                   NGIEIAAIPMTLAMEDPDTGEMVSELRDLSDGIAEIHDGVGELNDGVFELVDGLWTLTD
FT                   GSSDFLSGLREVDGSSGDLVHGSREIRDGLAQLDRELDVSEFDMDVDLNGFDELTKGLH
FT                   ELSGGLEELSGGLGLLGDQYEEARKALDEAVKAIPEEVPSEEAIKALYMTTEDHETLDS
FT                   LVDQYAAAQRVKQTYDAVSGAFDAVTGTLGEAVKGLDESVTGLRTMASELEASLASFED
FT                   LEDPEALEGLRELERGIGELSSNYHAFHDGLVSYTGGVGELAGNYRDLDDGVSEAADGT
FT                   RELGDGTDELYDGTGELEENTRDLPDQIQDEVDELMAEYDKSDYEPVSFVSERNEQVSV
FT                   VQFVLRTDAIELPDDEDGELAEEDEENWFDRIMNLFS"
     MNKWTAGLLA ALILPPVYIG FADDTAHDNE TPETSGTDGE VASKEEVIYG NLNHDGSVTD        60
     LYVVNMLDVT SAGRIVDYGN YDSVQNLTSL AEIQIDGDEI SAEAEEGWFY YQGNKDGATL       120
     PWAMDITYTL DGEEVDAGDL AGADGHLHLS LTTEANDGVN PSFYENYTLQ VSVSFDASVA       180
     GNIHAPDATV ANAGKERQLS YTVMPETDGD IEFFADVTDF EMNGIEIAAI PMTLAMEDPD       240
     TGEMVSELRD LSDGIAEIHD GVGELNDGVF ELVDGLWTLT DGSSDFLSGL REVDGSSGDL       300
     VHGSREIRDG LAQLDRELDV SEFDMDVDLN GFDELTKGLH ELSGGLEELS GGLGLLGDQY       360
     EEARKALDEA VKAIPEEVPS EEAIKALYMT TEDHETLDSL VDQYAAAQRV KQTYDAVSGA       420
     FDAVTGTLGE AVKGLDESVT GLRTMASELE ASLASFEDLE DPEALEGLRE LERGIGELSS       480
     NYHAFHDGLV SYTGGVGELA GNYRDLDDGV SEAADGTREL GDGTDELYDG TGELEENTRD       540
     LPDQIQDEVD ELMAEYDKSD YEPVSFVSER NEQVSVVQFV LRTDAIELPD DEDGELAEED       600
     EENWFDRIMN LFS                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page