(data stored in ACNUC7421 zone)

EMBL: CP001791.PE384

CP001791.PE384       Location/Qualifiers
FT   CDS             complement(414718..415263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0396"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   asa:ASA_3441 ribosomal-protein-serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97936"
FT                   /db_xref="GOA:D6XX79"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX79"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH97936.1"
FT                   /translation="MFYHQLDEDTELRILELRHAEPLYLITEHSRRHLRTWLPWVDDIY
FT                   QPGDSRKFIEMGLKQFVSQDGFHAGIWYKGQLAGVIGLHGIHWGNRSTSIGYWLGDGFE
FT                   GKGIMTKACKALIHHCFHDLNLERIEIRAASRNTKSRAIPERLGFQEEGRLRHAEFLYD
FT                   HFVDHIVYARLKSDEADI"
     MFYHQLDEDT ELRILELRHA EPLYLITEHS RRHLRTWLPW VDDIYQPGDS RKFIEMGLKQ        60
     FVSQDGFHAG IWYKGQLAGV IGLHGIHWGN RSTSIGYWLG DGFEGKGIMT KACKALIHHC       120
     FHDLNLERIE IRAASRNTKS RAIPERLGFQ EEGRLRHAEF LYDHFVDHIV YARLKSDEAD       180
     I                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page