(data stored in ACNUC7421 zone)

EMBL: CP001791.PE387

CP001791.PE387       Location/Qualifiers
FT   CDS             416939..417958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_4664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97939"
FT                   /db_xref="InterPro:IPR021243"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX82"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_4664"
FT                   /protein_id="ADH97939.1"
FT                   /translation="MQAMELTKPVRLSLNDGTLNPESAGWARHPIVTSNLSGASMRKKK
FT                   WNYWCITSDDILFSATISHIDYAASLFVYLYDRHTGEFVEKTVTVPFGIGVRMPEEVRA
FT                   PLFVDRSGFTIRFLEKPDATELFVNIRDFGGKPLDAYVEIARPKGYESLNVVIPWSESH
FT                   YQYTSKQPALPAFGTVEWGGYRHHLDKRNQSFACLDFGRGKWPYRSSWNWGSASGRDKD
FT                   GRVIGLNLGGKWTDGTGQNENGIVVDGVLCKIHEDLDWDYDPSDLMRPWTIRDKGNETV
FT                   TLTFYPSFERLAETNLGVIQSKVHQMFGHYEGTVMTDGAGTVQISDLFGWAEDHHAKW"
     MQAMELTKPV RLSLNDGTLN PESAGWARHP IVTSNLSGAS MRKKKWNYWC ITSDDILFSA        60
     TISHIDYAAS LFVYLYDRHT GEFVEKTVTV PFGIGVRMPE EVRAPLFVDR SGFTIRFLEK       120
     PDATELFVNI RDFGGKPLDA YVEIARPKGY ESLNVVIPWS ESHYQYTSKQ PALPAFGTVE       180
     WGGYRHHLDK RNQSFACLDF GRGKWPYRSS WNWGSASGRD KDGRVIGLNL GGKWTDGTGQ       240
     NENGIVVDGV LCKIHEDLDW DYDPSDLMRP WTIRDKGNET VTLTFYPSFE RLAETNLGVI       300
     QSKVHQMFGH YEGTVMTDGA GTVQISDLFG WAEDHHAKW                              339
//

If you have problems or comments...

PBIL Back to PBIL home page