(data stored in ACNUC7421 zone)

EMBL: CP001791.PE388

CP001791.PE388       Location/Qualifiers
FT   CDS             complement(418008..420221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97940"
FT                   /db_xref="GOA:D6XX83"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97940.1"
FT                   /translation="MTIRLKVKHLVYSLLAFLALFAVVLLVFEPKLHEWQIDRQIASGQ
FT                   EDGAREQILDRIVRNQTASTGLIETYMITPLSEDASSLTISPASTSWSTSDTPVLFTLE
FT                   EAAPYLKTYLEEGEDTIHLLSAADLLMRHDQTNGDPEGVLETMETASERQTAYPAHQTD
FT                   LTFDAIGILIEMNEHELARSILNACEDTFDSGDAALRSAILHARMDLYEEDYEEAHALL
FT                   QDAMERYEAHHDEQETAHAESQNGYEPFNLDQAVYFQEAKRLHERLEPLEEGRHNGTVE
FT                   GRVTGADGEPLAHTRVFLQEDAQRDRSLNRESALATKTDGDGYYRFDGVIPDDYLPFVM
FT                   LSMDEVSGSAWPVDANEVIRVEDGDTATYDITFTPLIEQHEPINHDEITDDTITFSWED
FT                   VDGAAFYSLELTVHHDGGSMTQSVETDITSNRHTIETDALYDRTFGVMSDPEDDELIQP
FT                   ETILAFSYPDGEFSWNVRAFDEDRSPIAQSNGYRLDEDAMGQLPFFRLDTRTLTNADRR
FT                   LLDEDVPGALEAYRNAYADDPEDAHSLRMLTRLNGFSESRAEETMMYRRQLHDVAPSIA
FT                   NVSELLRHTMREGDLTEASRWKEAYLDLLEEDEPNELENGRFALINAFEGEFDQAQERL
FT                   AQSVDADSYNRFSGARAVVALASGQGLDEALAIVRQNPERTRSNLAAENWERHLEHLEG
FT                   MEEDFLQEAAQAMLTRDQDAIDVLTDEHPSLSSLTDAWQDRDW"
     MTIRLKVKHL VYSLLAFLAL FAVVLLVFEP KLHEWQIDRQ IASGQEDGAR EQILDRIVRN        60
     QTASTGLIET YMITPLSEDA SSLTISPAST SWSTSDTPVL FTLEEAAPYL KTYLEEGEDT       120
     IHLLSAADLL MRHDQTNGDP EGVLETMETA SERQTAYPAH QTDLTFDAIG ILIEMNEHEL       180
     ARSILNACED TFDSGDAALR SAILHARMDL YEEDYEEAHA LLQDAMERYE AHHDEQETAH       240
     AESQNGYEPF NLDQAVYFQE AKRLHERLEP LEEGRHNGTV EGRVTGADGE PLAHTRVFLQ       300
     EDAQRDRSLN RESALATKTD GDGYYRFDGV IPDDYLPFVM LSMDEVSGSA WPVDANEVIR       360
     VEDGDTATYD ITFTPLIEQH EPINHDEITD DTITFSWEDV DGAAFYSLEL TVHHDGGSMT       420
     QSVETDITSN RHTIETDALY DRTFGVMSDP EDDELIQPET ILAFSYPDGE FSWNVRAFDE       480
     DRSPIAQSNG YRLDEDAMGQ LPFFRLDTRT LTNADRRLLD EDVPGALEAY RNAYADDPED       540
     AHSLRMLTRL NGFSESRAEE TMMYRRQLHD VAPSIANVSE LLRHTMREGD LTEASRWKEA       600
     YLDLLEEDEP NELENGRFAL INAFEGEFDQ AQERLAQSVD ADSYNRFSGA RAVVALASGQ       660
     GLDEALAIVR QNPERTRSNL AAENWERHLE HLEGMEEDFL QEAAQAMLTR DQDAIDVLTD       720
     EHPSLSSLTD AWQDRDW                                                      737
//

If you have problems or comments...

PBIL Back to PBIL home page