(data stored in ACNUC7421 zone)

EMBL: CP001791.PE389

CP001791.PE389       Location/Qualifiers
FT   CDS             complement(420218..420523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97941"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97941.1"
FT                   /translation="MMNDDQKPAVRQALDRELQHETFHGHDAVLKRTHPVTWKDRLANV
FT                   WNKEVRIPVVPLGAALFLLITSGTTIAVPGDEPERELIERGGSYYWHDLFEEEDSS"
     MMNDDQKPAV RQALDRELQH ETFHGHDAVL KRTHPVTWKD RLANVWNKEV RIPVVPLGAA        60
     LFLLITSGTT IAVPGDEPER ELIERGGSYY WHDLFEEEDS S                           101
//

If you have problems or comments...

PBIL Back to PBIL home page