(data stored in ACNUC7421 zone)

EMBL: CP001791.PE390

CP001791.PE390       Location/Qualifiers
FT   CDS             complement(420520..421065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0402"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: bbt:BBta_3011 RNA polymerase sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: Sigma-70 region 4 type 2; sigma-70 region 2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97942"
FT                   /db_xref="GOA:D6XX85"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX85"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH97942.1"
FT                   /translation="MDYKTQLQQGDESALKALMDAYGPLLKRTAVLLVKDRQLAEEVVQ
FT                   DTFITAFRKSHQLSSNDKIKGWLVTITLNGCRSRMRTWNWRHLFPAKDETAFDQLEETA
FT                   LLPEAQLLAAIEEQRVHKAVQALPYSYREPITLYYFHDMTVDELAGVMNTKQNTVKTRL
FT                   ARGRALLKNELSKGGDDR"
     MDYKTQLQQG DESALKALMD AYGPLLKRTA VLLVKDRQLA EEVVQDTFIT AFRKSHQLSS        60
     NDKIKGWLVT ITLNGCRSRM RTWNWRHLFP AKDETAFDQL EETALLPEAQ LLAAIEEQRV       120
     HKAVQALPYS YREPITLYYF HDMTVDELAG VMNTKQNTVK TRLARGRALL KNELSKGGDD       180
     R                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page