(data stored in ACNUC7421 zone)

EMBL: CP001791.PE391

CP001791.PE391       Location/Qualifiers
FT   CDS             421405..421974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0403"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="KEGG: eba:p2A138 UbiX related subunit of putative
FT                   (de) carboxylase; TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97943"
FT                   /db_xref="GOA:D6XX86"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX86"
FT                   /inference="protein motif:TFAM:TIGR00421"
FT                   /protein_id="ADH97943.1"
FT                   /translation="MTKRIIIGMSGSTGPIYGIRLLEVLRDLGVETHLILSQWGEKTIT
FT                   IETDYTVDEVKKLASYVHPATNQAAAISSGSFKTDGMVIVPCSMKTLSAVAHGYADNLV
FT                   SRAADVVLKERRKLIMVPRETPLNDIHLENMLKLSRMGVVMMPPMPAFYNKPESIGDMV
FT                   DHTVSRLLDQLDIDNSLTRRWLEKED"
     MTKRIIIGMS GSTGPIYGIR LLEVLRDLGV ETHLILSQWG EKTITIETDY TVDEVKKLAS        60
     YVHPATNQAA AISSGSFKTD GMVIVPCSMK TLSAVAHGYA DNLVSRAADV VLKERRKLIM       120
     VPRETPLNDI HLENMLKLSR MGVVMMPPMP AFYNKPESIG DMVDHTVSRL LDQLDIDNSL       180
     TRRWLEKED                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page