(data stored in ACNUC7421 zone)

EMBL: CP001791.PE395

CP001791.PE395       Location/Qualifiers
FT   CDS             complement(426338..426862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0407"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   kpn:KPN_pKPN3p05928 N-acetyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97947"
FT                   /db_xref="GOA:D6XX90"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX90"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH97947.1"
FT                   /translation="MTDILIRPMTVQEWPAVSAIYQAGLDTELATFETVVPSWDSWNQA
FT                   HHETCRLIAEYGGTIAGWAALAPTSPRYAYRGVAEISIYIAPGASGLGVGRTLLNALIE
FT                   DSEKAGFWTIQSAIFRENQASIHLHKKCGFRQIGYREQVAERHGVWHDIILMERRSPIV
FT                   AASPSARPDPS"
     MTDILIRPMT VQEWPAVSAI YQAGLDTELA TFETVVPSWD SWNQAHHETC RLIAEYGGTI        60
     AGWAALAPTS PRYAYRGVAE ISIYIAPGAS GLGVGRTLLN ALIEDSEKAG FWTIQSAIFR       120
     ENQASIHLHK KCGFRQIGYR EQVAERHGVW HDIILMERRS PIVAASPSAR PDPS             174
//

If you have problems or comments...

PBIL Back to PBIL home page