(data stored in ACNUC7421 zone)

EMBL: CP001791.PE396

CP001791.PE396       Location/Qualifiers
FT   CDS             427935..429953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0409"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: hha:Hhal_0549 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97948"
FT                   /db_xref="GOA:D6XX91"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX91"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADH97948.1"
FT                   /translation="MKSIRMRLILYFSAIMIVATGILGIVITNGAGDALIDEAETGLET
FT                   LALEGAKVTDSRLDSEYLYLEGLTNLPEITGDDPDLDAAMDVLLDEVENTDYLRIGITD
FT                   LDGNLYLSDSYGIDGEIVDVTEREYYHDSLAGERGLMPPSLSVNPDDGDRLIMVTSVPI
FT                   EEDGAITGVLVAVGDADYLNTIVDDIQYGEGGYAYMIDDEGTVVAHRDRDMVRDAFNPL
FT                   RLVEEDPGLETLANQFSRMLSEPAGIGNYAFQGNDLYVGFSDIGETGWTLVITANENEV
FT                   LAAIPSLRNTALIMTFLVVVGGIALTYVVGTRISRPIQAVSRTAAEIGQLDMRHDMDLK
FT                   LLSRHDEVGELAKSLQSVTENVRKIIVDINASAGEVSAASEELTATSGESSRASEEVAS
FT                   TVQDIAEGASSQAQNTEAGSEKAARLGEIVDEEKEVVQRLNEAFVNVNHAIQEGLEEIG
FT                   RLSEISDQTAEATQEVEKGIVKTNDSSRRIGEASTVIANIAEQTNLLALNAAIEAARAG
FT                   EAGKGFSVVADEIRKLAEQSTTSTATIDEIVRELQVNAEQSVKVMADVSQILDEQLKSV
FT                   QGTRDKYEQIEGAMSISDEAVHRLNGTGKDMATIKEDIVSSLESLSAIAEENSAATEEV
FT                   SAAMQEQTASMEEIAGSSESLAHLATELKQLVEKFKI"
     MKSIRMRLIL YFSAIMIVAT GILGIVITNG AGDALIDEAE TGLETLALEG AKVTDSRLDS        60
     EYLYLEGLTN LPEITGDDPD LDAAMDVLLD EVENTDYLRI GITDLDGNLY LSDSYGIDGE       120
     IVDVTEREYY HDSLAGERGL MPPSLSVNPD DGDRLIMVTS VPIEEDGAIT GVLVAVGDAD       180
     YLNTIVDDIQ YGEGGYAYMI DDEGTVVAHR DRDMVRDAFN PLRLVEEDPG LETLANQFSR       240
     MLSEPAGIGN YAFQGNDLYV GFSDIGETGW TLVITANENE VLAAIPSLRN TALIMTFLVV       300
     VGGIALTYVV GTRISRPIQA VSRTAAEIGQ LDMRHDMDLK LLSRHDEVGE LAKSLQSVTE       360
     NVRKIIVDIN ASAGEVSAAS EELTATSGES SRASEEVAST VQDIAEGASS QAQNTEAGSE       420
     KAARLGEIVD EEKEVVQRLN EAFVNVNHAI QEGLEEIGRL SEISDQTAEA TQEVEKGIVK       480
     TNDSSRRIGE ASTVIANIAE QTNLLALNAA IEAARAGEAG KGFSVVADEI RKLAEQSTTS       540
     TATIDEIVRE LQVNAEQSVK VMADVSQILD EQLKSVQGTR DKYEQIEGAM SISDEAVHRL       600
     NGTGKDMATI KEDIVSSLES LSAIAEENSA ATEEVSAAMQ EQTASMEEIA GSSESLAHLA       660
     TELKQLVEKF KI                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page