(data stored in ACNUC7421 zone)

EMBL: CP001791.PE4

CP001791.PE4         Location/Qualifiers
FT   CDS             3921..5042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: gur:Gura_0003 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97556"
FT                   /db_xref="GOA:D6XUZ8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D6XUZ8"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADH97556.1"
FT                   /translation="MHINELKLTDYRNYTKLHLTFENRVNVFLGENAQGKTNVMEAIYV
FT                   LAMARSHRTAKDRELIRWDQPFARVEGAVTNRNGAMKLEMIFSGRGKKVKLNALERKRL
FT                   SDYIGACTIVMFAPEDLALVKGSPQIRRRFLDMEMGQIFTIYLYYLSQYYKLLKQRNTW
FT                   LKQLQQKSSSFDEGMWHVLTEQLVEAGAEVIQRRFSFLNKLEAWATPIHSAISRDKETL
FT                   TLHYESTVKADDEMSVDVIKQVFFEQFQQVMEQEIRRGTTIIGPHRDDVAFFVNDRNVQ
FT                   TYGSQGQQRTAALSVKLAEIELIHEKTGEYPILLLDDVLSELDDHRQTHLLNSIQGKVQ
FT                   TFVTTTSVEGIHHEMLEKASTYLVNDGVIEQQE"
     MHINELKLTD YRNYTKLHLT FENRVNVFLG ENAQGKTNVM EAIYVLAMAR SHRTAKDREL        60
     IRWDQPFARV EGAVTNRNGA MKLEMIFSGR GKKVKLNALE RKRLSDYIGA CTIVMFAPED       120
     LALVKGSPQI RRRFLDMEMG QIFTIYLYYL SQYYKLLKQR NTWLKQLQQK SSSFDEGMWH       180
     VLTEQLVEAG AEVIQRRFSF LNKLEAWATP IHSAISRDKE TLTLHYESTV KADDEMSVDV       240
     IKQVFFEQFQ QVMEQEIRRG TTIIGPHRDD VAFFVNDRNV QTYGSQGQQR TAALSVKLAE       300
     IELIHEKTGE YPILLLDDVL SELDDHRQTH LLNSIQGKVQ TFVTTTSVEG IHHEMLEKAS       360
     TYLVNDGVIE QQE                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page