(data stored in ACNUC7421 zone)

EMBL: CP001791.PE400

CP001791.PE400       Location/Qualifiers
FT   CDS             433055..434440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0413"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mlo:mlr6435 ABC transporter sugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97952"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX95"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADH97952.1"
FT                   /translation="MKAWKVLSVSALSVGLLAACGGNDEGDAGANNGENDSANNGSASA
FT                   NNDDANENNNAGDGDEDISGEVTAWGWNVAAAAMEQAIEGFNELYPNVTVNIEDIGRED
FT                   VYDRLTVGLAAGGSGLPDISMVETDRLDNYFAEFPQGFVNLDEYGFNEHEDKFADSKVE
FT                   AVKGPDGNNLAAPWDIGPAGVFYYVPHFEEAGVDPDDIETWDDFIAAGEDILDATGAAM
FT                   VPVDIANDDAIFRMMMNQLGVYYFDADGAIEIASDDAALAMSKIQEMHEKDLVANVDGW
FT                   DGTVTSTVNHTVATIPFGVWYAGTITDQAPDQSGDWGVFKLPAFEEGGNRDANLGGSDL
FT                   TILSSTEYPEAAYAFVEYFTTEIEPQIEGMTEYGLFPSLLATYDEPYFQENNEFFNDEP
FT                   IWSLFADVVEGTLPANYTNDYARAFRYASDAQANALLSGEDVQVALQEAAERIANETGR
FT                   DIQ"
     MKAWKVLSVS ALSVGLLAAC GGNDEGDAGA NNGENDSANN GSASANNDDA NENNNAGDGD        60
     EDISGEVTAW GWNVAAAAME QAIEGFNELY PNVTVNIEDI GREDVYDRLT VGLAAGGSGL       120
     PDISMVETDR LDNYFAEFPQ GFVNLDEYGF NEHEDKFADS KVEAVKGPDG NNLAAPWDIG       180
     PAGVFYYVPH FEEAGVDPDD IETWDDFIAA GEDILDATGA AMVPVDIAND DAIFRMMMNQ       240
     LGVYYFDADG AIEIASDDAA LAMSKIQEMH EKDLVANVDG WDGTVTSTVN HTVATIPFGV       300
     WYAGTITDQA PDQSGDWGVF KLPAFEEGGN RDANLGGSDL TILSSTEYPE AAYAFVEYFT       360
     TEIEPQIEGM TEYGLFPSLL ATYDEPYFQE NNEFFNDEPI WSLFADVVEG TLPANYTNDY       420
     ARAFRYASDA QANALLSGED VQVALQEAAE RIANETGRDI Q                           461
//

If you have problems or comments...

PBIL Back to PBIL home page