(data stored in ACNUC7421 zone)

EMBL: CP001791.PE403

CP001791.PE403       Location/Qualifiers
FT   CDS             436324..439407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0416"
FT                   /product="glycoside hydrolase family 2 TIM barrel"
FT                   /note="PFAM: glycoside hydrolase family 2 TIM barrel;
FT                   glycoside hydrolase family 42 domain 5 loop region;
FT                   glycoside hydrolase family 2 sugar binding; glycoside
FT                   hydrolase family 2 immunoglobulin domain protein
FT                   beta-sandwich; KEGG: avi:Avi_5411 beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97955"
FT                   /db_xref="GOA:D6XX98"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX98"
FT                   /inference="protein motif:PFAM:PF02836"
FT                   /protein_id="ADH97955.1"
FT                   /translation="MAMHEQTARRTYHPPENGYPEWNNNPELFQINREAPHADPRLYDT
FT                   KEKAVAGDPDQVAWRRSLNGTWSFLYADTPKERVEDFYTWDAGDERFTTVQVPGHLQLQ
FT                   GFDYPHYTNTRYPWEEREDIKPPFAPVNYNPVGQYMRTFTMTGEPGDRPVYLRFEGVEA
FT                   AFYLWINGTFAGYSEDSFTPSEFEISDLVHAGENTVAVEVYHWCDSSWLEDQDFWRFSG
FT                   IFRDVWLYETPAEQIRDYTVKTSFHGTDGLLDLDVLIRRFKTKEVRELTVKADVYTYPD
FT                   QKPVAEGAVTGSGDRMTLQITVPDVLRWSAETPNLYIVVLTLQDEAGEAILYVHQKTGF
FT                   QEFGLKDGLMTLNGAPLLFRGVNRHEFMPDKGRAGITREEMEADLILMKQHNINAVRTS
FT                   HYPNHPAFYELCDIYGLYVIDEVNMETHGTWVYGQEGIGETIPGNRPEWTENVLDRCRS
FT                   LYERDKNATSVIIWSLGNESFGGSNLKEMYDYFKEKDETRLVHYEGIFHYREYDASDME
FT                   STMYIPPHKVEDYAKEAEGNPDAKPYILCEYSHAMGNSLGNFHKYTDLFLKYPILQGGF
FT                   IWDWRDQALWSTRPDGTAFLAYGGDFGDTPTDGNFSGNGLIFADGTATPKLLEAKKGYE
FT                   PARIRFEGNHIHVTNDYAFLDLDGFRCQWELLSDGKTVREGTLSLKGAPGSTHSYAVDL
FT                   PETEGERILEVRLVLGEDTLWAEAGHEMTFEQFILNDNGAPRSETPRGQANVSHDDGEW
FT                   LSVAAGGVTYTFARDTGDLTEVTKDGKQHLTAPVAPNFHRAMTDNDRGSGLPKRSAVWR
FT                   KAGKNRRLNAFGVEESGESVHVTVDYAFPDAGSSSMRVMYTLNGSGKAAVSFRFTPDNA
FT                   MPEIPEVGLMMQLAPSLTELQWYGRGPHETYQDRFRSARIGIHESTVNERLTPYLKPQE
FT                   CGNMTGVRWLTLTNPDGSGIRITGSGDLEANALPYSPEELELATHQDRLPQPRHTVLRL
FT                   NAAQMGVGGDDSWGQKTHDEYTLFTDRTFEASFDLTLI"
     MAMHEQTARR TYHPPENGYP EWNNNPELFQ INREAPHADP RLYDTKEKAV AGDPDQVAWR        60
     RSLNGTWSFL YADTPKERVE DFYTWDAGDE RFTTVQVPGH LQLQGFDYPH YTNTRYPWEE       120
     REDIKPPFAP VNYNPVGQYM RTFTMTGEPG DRPVYLRFEG VEAAFYLWIN GTFAGYSEDS       180
     FTPSEFEISD LVHAGENTVA VEVYHWCDSS WLEDQDFWRF SGIFRDVWLY ETPAEQIRDY       240
     TVKTSFHGTD GLLDLDVLIR RFKTKEVREL TVKADVYTYP DQKPVAEGAV TGSGDRMTLQ       300
     ITVPDVLRWS AETPNLYIVV LTLQDEAGEA ILYVHQKTGF QEFGLKDGLM TLNGAPLLFR       360
     GVNRHEFMPD KGRAGITREE MEADLILMKQ HNINAVRTSH YPNHPAFYEL CDIYGLYVID       420
     EVNMETHGTW VYGQEGIGET IPGNRPEWTE NVLDRCRSLY ERDKNATSVI IWSLGNESFG       480
     GSNLKEMYDY FKEKDETRLV HYEGIFHYRE YDASDMESTM YIPPHKVEDY AKEAEGNPDA       540
     KPYILCEYSH AMGNSLGNFH KYTDLFLKYP ILQGGFIWDW RDQALWSTRP DGTAFLAYGG       600
     DFGDTPTDGN FSGNGLIFAD GTATPKLLEA KKGYEPARIR FEGNHIHVTN DYAFLDLDGF       660
     RCQWELLSDG KTVREGTLSL KGAPGSTHSY AVDLPETEGE RILEVRLVLG EDTLWAEAGH       720
     EMTFEQFILN DNGAPRSETP RGQANVSHDD GEWLSVAAGG VTYTFARDTG DLTEVTKDGK       780
     QHLTAPVAPN FHRAMTDNDR GSGLPKRSAV WRKAGKNRRL NAFGVEESGE SVHVTVDYAF       840
     PDAGSSSMRV MYTLNGSGKA AVSFRFTPDN AMPEIPEVGL MMQLAPSLTE LQWYGRGPHE       900
     TYQDRFRSAR IGIHESTVNE RLTPYLKPQE CGNMTGVRWL TLTNPDGSGI RITGSGDLEA       960
     NALPYSPEEL ELATHQDRLP QPRHTVLRLN AAQMGVGGDD SWGQKTHDEY TLFTDRTFEA      1020
     SFDLTLI                                                                1027
//

If you have problems or comments...

PBIL Back to PBIL home page