(data stored in ACNUC7421 zone)

EMBL: CP001791.PE404

CP001791.PE404       Location/Qualifiers
FT   CDS             439554..440594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0417"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: vfm:VFMJ11_A0386 DNA-binding transcriptional
FT                   repressor EbgR; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97956"
FT                   /db_xref="GOA:D6XX99"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6XX99"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADH97956.1"
FT                   /translation="MATMKDIAEKSGYSIATVSRVLNQDASLAVTDATKEKIFQVAQSL
FT                   GYKTLRDKRSEKEAQDPSRLTMGLVYYRTEEQELSDPYFLSIRLGVENKCARMGVTLEK
FT                   IYRENDNAALQIPSDVDGLIVVGRVSEGEIARLREVTGSLTFVDYPADSRQYDAVVIDF
FT                   AEAMEVVLAELTGLGHRSIGFIGGHRHFPPDEIVRDEREHAFRYYLDRRGLLDEALIYT
FT                   GDFNTSEGYRLMTEALQAQNRPTAFFIASDSMAIGAYRAAFEAGVRIPEDLSVVGFNDI
FT                   SASSYLQPSLSTVKVYTEFMGETAVDLAIERIRTKREIPKKVVLPTEFIRRESLKERTQ
FT                   SSRNKT"
     MATMKDIAEK SGYSIATVSR VLNQDASLAV TDATKEKIFQ VAQSLGYKTL RDKRSEKEAQ        60
     DPSRLTMGLV YYRTEEQELS DPYFLSIRLG VENKCARMGV TLEKIYREND NAALQIPSDV       120
     DGLIVVGRVS EGEIARLREV TGSLTFVDYP ADSRQYDAVV IDFAEAMEVV LAELTGLGHR       180
     SIGFIGGHRH FPPDEIVRDE REHAFRYYLD RRGLLDEALI YTGDFNTSEG YRLMTEALQA       240
     QNRPTAFFIA SDSMAIGAYR AAFEAGVRIP EDLSVVGFND ISASSYLQPS LSTVKVYTEF       300
     MGETAVDLAI ERIRTKREIP KKVVLPTEFI RRESLKERTQ SSRNKT                      346
//

If you have problems or comments...

PBIL Back to PBIL home page