(data stored in ACNUC7421 zone)

EMBL: CP001791.PE405

CP001791.PE405       Location/Qualifiers
FT   CDS             complement(440627..442846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0418"
FT                   /product="glycoside hydrolase clan GH-D"
FT                   /note="PFAM: glycoside hydrolase clan GH-D; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97957"
FT                   /db_xref="GOA:D6XXA0"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA0"
FT                   /inference="protein motif:PFAM:PF02065"
FT                   /protein_id="ADH97957.1"
FT                   /translation="MIHVNEPALEFHLQNSEVSYLFSVMKNRQLAHLYFGKRIHHEADF
FT                   SHLFRTQARAGMACVYEGDLTFSLDVIRQEYPSYGTSDFREPAFLLEEPKGSRITDFVF
FT                   DSWERLPGKPAIQGLPHVYADHDSEAETLVITLKDPVLNARLRLFWTIYADRPVITRHA
FT                   EFINDSKDTYRLHRAMSMNLDLFDSDYEMVQLSGSWARERHQHTMPLRPGVQSISSTRG
FT                   TSSAQQNPFLALKRPDTNEHHGDVYGFNLVYSGNFLARAEVDQFDVTRVSMGINPFDFS
FT                   WKLEGGETFTTPEAVLVHVTDGLNGMSRAFHALYRERLARGTWRDRDRPVLINNWEATY
FT                   FDFDEEKLLTIAKSAKELGVELFVLDDGWFGKRNDDTTSLGDWHANTAKLPEGVKGIAE
FT                   KINALGLSFGLWFEPEMVNKDSDLYRNHPDWVIHVPGRAMSHGRNQFVLDCSRQDVVDY
FT                   LFRRMAAVLDSAPVDYVKWDMNRYMTEIGSAKLPADRQQELPHRYILGVYELYERLTSA
FT                   FPHILFESCASGGARFDPGMLYYAPQAWTSDNTDAVERLKIQYGTSLAYPLSSMGAHVS
FT                   AVPNHQVHRHTSLEMRGDVSLFGMFGYELDLSLFTDKEKAAIKEQISRYKQHRALIRTG
FT                   TFYRLKSPFGPDGNETAWMVVSADQTEALVGWYRELARPHPGFKRLHLQGLNEDVAYRI
FT                   NDRVIHGSQLMHAGLMLPDEASGSVPPTTEKTGDFVSYVFHLSAE"
     MIHVNEPALE FHLQNSEVSY LFSVMKNRQL AHLYFGKRIH HEADFSHLFR TQARAGMACV        60
     YEGDLTFSLD VIRQEYPSYG TSDFREPAFL LEEPKGSRIT DFVFDSWERL PGKPAIQGLP       120
     HVYADHDSEA ETLVITLKDP VLNARLRLFW TIYADRPVIT RHAEFINDSK DTYRLHRAMS       180
     MNLDLFDSDY EMVQLSGSWA RERHQHTMPL RPGVQSISST RGTSSAQQNP FLALKRPDTN       240
     EHHGDVYGFN LVYSGNFLAR AEVDQFDVTR VSMGINPFDF SWKLEGGETF TTPEAVLVHV       300
     TDGLNGMSRA FHALYRERLA RGTWRDRDRP VLINNWEATY FDFDEEKLLT IAKSAKELGV       360
     ELFVLDDGWF GKRNDDTTSL GDWHANTAKL PEGVKGIAEK INALGLSFGL WFEPEMVNKD       420
     SDLYRNHPDW VIHVPGRAMS HGRNQFVLDC SRQDVVDYLF RRMAAVLDSA PVDYVKWDMN       480
     RYMTEIGSAK LPADRQQELP HRYILGVYEL YERLTSAFPH ILFESCASGG ARFDPGMLYY       540
     APQAWTSDNT DAVERLKIQY GTSLAYPLSS MGAHVSAVPN HQVHRHTSLE MRGDVSLFGM       600
     FGYELDLSLF TDKEKAAIKE QISRYKQHRA LIRTGTFYRL KSPFGPDGNE TAWMVVSADQ       660
     TEALVGWYRE LARPHPGFKR LHLQGLNEDV AYRINDRVIH GSQLMHAGLM LPDEASGSVP       720
     PTTEKTGDFV SYVFHLSAE                                                    739
//

If you have problems or comments...

PBIL Back to PBIL home page