(data stored in ACNUC7421 zone)

EMBL: CP001791.PE407

CP001791.PE407       Location/Qualifiers
FT   CDS             444291..445292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0420"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="KEGG: dds:Ddes_1950 UDP-glucose 4-epimerase;
FT                   TIGRFAM: UDP-glucose 4-epimerase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; Male sterility domain; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97959"
FT                   /db_xref="GOA:D6XXA2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA2"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ADH97959.1"
FT                   /translation="MAVLVCGGAGYIGSHAVADLLASGEQVVVVDNLQTGHRGAVDDGA
FT                   VFYQADLRDEEALERVFNSHNIESVMHFAADSLVGVSMNEPLAYYDNNVYGALCLLKKM
FT                   KKHGVKRIVFSSTAATYGEPDEVPITEEMATNPTNPYGETKLAIERMMKWADEAHEIRY
FT                   VVLRYFNVAGAHPEKDIGEDHRPETHLIPIILQVALGQREKIMVFGDDYDTPDGTCIRD
FT                   YIHVTDLIQAHILALRYLRKGGTSDVFNLGNGSGFSVQEVIDTVETVTGKTIPRELAPR
FT                   RAGDPAQLIASSGKAKQVLGWAPERADLATIIATAWDWHQRHPDGYGEGSEA"
     MAVLVCGGAG YIGSHAVADL LASGEQVVVV DNLQTGHRGA VDDGAVFYQA DLRDEEALER        60
     VFNSHNIESV MHFAADSLVG VSMNEPLAYY DNNVYGALCL LKKMKKHGVK RIVFSSTAAT       120
     YGEPDEVPIT EEMATNPTNP YGETKLAIER MMKWADEAHE IRYVVLRYFN VAGAHPEKDI       180
     GEDHRPETHL IPIILQVALG QREKIMVFGD DYDTPDGTCI RDYIHVTDLI QAHILALRYL       240
     RKGGTSDVFN LGNGSGFSVQ EVIDTVETVT GKTIPRELAP RRAGDPAQLI ASSGKAKQVL       300
     GWAPERADLA TIIATAWDWH QRHPDGYGEG SEA                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page