(data stored in ACNUC7421 zone)

EMBL: CP001791.PE408

CP001791.PE408       Location/Qualifiers
FT   CDS             445292..446806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0421"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   KEGG: hypothetical protein; K00964 galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97960"
FT                   /db_xref="GOA:D6XXA3"
FT                   /db_xref="InterPro:IPR000766"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR023425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA3"
FT                   /inference="protein motif:TFAM:TIGR01239"
FT                   /protein_id="ADH97960.1"
FT                   /translation="MEQTLNELISYALERELIEEADTVYVKNRLLDAMGLTEGETDAFQ
FT                   RSEEIRPLYTILDELTDDALKRGLIEDDTVTMRDLFDTELMGILTDRPAHVIRTFRDIE
FT                   REQGIEAATAWFYEFSQDVHYIRRERIAKNRSWQTETDYGALDITINLSKPEKDPKEIA
FT                   KAKEAGEANYPLCLLCKENEGYSGRVNHPARQNLRVIPVTLAGDPWFVQFSPYVYYHEH
FT                   AIVLSSAHEPMSIRRKTFERLLDFVEQYPHYFIGSNADLPIVGGSILSHDHYQAGKYEF
FT                   PMARAEMEEERSLERFADVTVGRVKWPMSVVRVKGESKAAVIMASEHILQGWRHYTDES
FT                   VDVRAFTGDTPHHTITPIARKRDGQFELDLVLRDNQTSSEHPSGIYHPHEDVHHIKKEN
FT                   IGLIEVMGLAVLPGRLDSELKALQEALAAEDPSGAIQSDEAIQKHHDWAMAILSRYGDV
FT                   AGDQGTRILQEEVGQVFHEILHHSGVFKRDDEGQAAFTRFLETLTR"
     MEQTLNELIS YALERELIEE ADTVYVKNRL LDAMGLTEGE TDAFQRSEEI RPLYTILDEL        60
     TDDALKRGLI EDDTVTMRDL FDTELMGILT DRPAHVIRTF RDIEREQGIE AATAWFYEFS       120
     QDVHYIRRER IAKNRSWQTE TDYGALDITI NLSKPEKDPK EIAKAKEAGE ANYPLCLLCK       180
     ENEGYSGRVN HPARQNLRVI PVTLAGDPWF VQFSPYVYYH EHAIVLSSAH EPMSIRRKTF       240
     ERLLDFVEQY PHYFIGSNAD LPIVGGSILS HDHYQAGKYE FPMARAEMEE ERSLERFADV       300
     TVGRVKWPMS VVRVKGESKA AVIMASEHIL QGWRHYTDES VDVRAFTGDT PHHTITPIAR       360
     KRDGQFELDL VLRDNQTSSE HPSGIYHPHE DVHHIKKENI GLIEVMGLAV LPGRLDSELK       420
     ALQEALAAED PSGAIQSDEA IQKHHDWAMA ILSRYGDVAG DQGTRILQEE VGQVFHEILH       480
     HSGVFKRDDE GQAAFTRFLE TLTR                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page