(data stored in ACNUC7421 zone)

EMBL: CP001791.PE41

CP001791.PE41        Location/Qualifiers
FT   CDS             complement(50546..50833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0042"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97593"
FT                   /db_xref="GOA:D6XV35"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV35"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADH97593.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLDIAEKDALEIYVDDERIIL
FT                   QKYKPNMTCQVTGEVSDDNLSIGNGKIILSPMGAKEIMKELEDYVAKNEA"
     MKSTGIVRKV DELGRVVIPI ELRRTLDIAE KDALEIYVDD ERIILQKYKP NMTCQVTGEV        60
     SDDNLSIGNG KIILSPMGAK EIMKELEDYV AKNEA                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page