(data stored in ACNUC7421 zone)

EMBL: CP001791.PE413

CP001791.PE413       Location/Qualifiers
FT   CDS             453888..454871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0427"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SMc01961 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97965"
FT                   /db_xref="GOA:D6XXA8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH97965.1"
FT                   /translation="MHTLKGLHHVTAITSSAEKNYEFFTYVLGMRLVKKTVNQDDIQTY
FT                   HLFFADDEGNAGTDMTFFDFPGIPKGSHGTNEFYRTSFRIPTDAALDYWVKRFERLQVK
FT                   HEGIQTVLGKKVLPFEDFDEQKYQLVSDEGQPGVASGIPWKKGPVPDEFAITGLGPMVT
FT                   RVKDIELFDKMITEVMGFTKEKEEGERRLYSVGEGGNGAQVITEHRPDLPNVQQGYGTV
FT                   HHTAFRVEDKEALDHWTETLNSFRFPNSGFVDRFYFKSLYARLAPNLLFEFATDGPGFM
FT                   GDEPYETLGEKLALPPAFESKREEIEKLVRPIDTVRSTRAIEKEYE"
     MHTLKGLHHV TAITSSAEKN YEFFTYVLGM RLVKKTVNQD DIQTYHLFFA DDEGNAGTDM        60
     TFFDFPGIPK GSHGTNEFYR TSFRIPTDAA LDYWVKRFER LQVKHEGIQT VLGKKVLPFE       120
     DFDEQKYQLV SDEGQPGVAS GIPWKKGPVP DEFAITGLGP MVTRVKDIEL FDKMITEVMG       180
     FTKEKEEGER RLYSVGEGGN GAQVITEHRP DLPNVQQGYG TVHHTAFRVE DKEALDHWTE       240
     TLNSFRFPNS GFVDRFYFKS LYARLAPNLL FEFATDGPGF MGDEPYETLG EKLALPPAFE       300
     SKREEIEKLV RPIDTVRSTR AIEKEYE                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page