(data stored in ACNUC7421 zone)

EMBL: CP001791.PE414

CP001791.PE414       Location/Qualifiers
FT   CDS             454874..455314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0428"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: gem:GM21_3065 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97966"
FT                   /db_xref="GOA:D6XXA9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XXA9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADH97966.1"
FT                   /translation="MSTSKEERALKLFIVLTRSMQAVKKKVEEDIRSHGLNTTEFAVLE
FT                   LIFHKGQQPIQRIGEKVLIASSSITYVVDKLVKKGYLTRETCSKDRRVSYAVLTEDGKA
FT                   LMDQIFPMHEQAIRRITAGLTEEEKDQATELLKKLGHHATKA"
     MSTSKEERAL KLFIVLTRSM QAVKKKVEED IRSHGLNTTE FAVLELIFHK GQQPIQRIGE        60
     KVLIASSSIT YVVDKLVKKG YLTRETCSKD RRVSYAVLTE DGKALMDQIF PMHEQAIRRI       120
     TAGLTEEEKD QATELLKKLG HHATKA                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page